{
    "uniprot_canonical_ac": "A0A5B6-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "sp|A0A5B6-1|TVB28_HUMAN Isoform 1 of T cell receptor beta variable 28  OS=Homo sapiens OX=9606 GN=TRBV28 PE=1 SV=1 CANONICAL=A0A5B6-1", 
        "length": 114, 
        "sequence": "MGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL"
    }, 
    "uniprot_id": "TVB28_HUMAN", 
    "enzyme_annotation": [], 
    "glycation": [], 
    "keywords": [
        "glycoprotein", 
        "reported.uniprotkb_gly"
    ], 
    "species": [
        {
            "common_name": "Human", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Homo sapiens", 
            "taxid": 9606
        }
    ], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/15040585", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "15040585"
                }
            ], 
            "title": "The many important facets of T-cell repertoire diversity.", 
            "journal": "Nat. Rev. Immunol.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Messaoudi I., Nikolich-Zugich J., Slifka M.K.", 
            "date": "2004"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/20452950", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "20452950"
                }
            ], 
            "title": "Structural biology of the T-cell receptor: insights into receptor assembly, ligand recognition, and initiation of signaling.", 
            "journal": "Cold Spring Harb. Perspect. Biol.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Gagnon E., Wucherpfennig K.W., Call M.E., Call M.J., Huseby E.S.", 
            "date": "2010"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/23524462", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "23524462"
                }
            ], 
            "title": "T cell receptor signalling networks: branched, diversified and bounded.", 
            "journal": "Nat. Rev. Immunol.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Zamoyska R., Brownlie R.J.", 
            "date": "2013"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/24600447", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "24600447"
                }
            ], 
            "title": "Immunoglobulin and T Cell Receptor Genes: IMGT((R)) and the Birth and Rise of Immunoinformatics.", 
            "journal": "Front. Immunol.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Lefranc M.P.", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/25493333", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "25493333"
                }
            ], 
            "title": "T cell antigen receptor recognition of antigen-presenting molecules.", 
            "journal": "Annu. Rev. Immunol.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Rossjohn J., Gras S., McCluskey J., Godfrey D.I., Miles J.J., Turner S.J.", 
            "date": "2015"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/8650574", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "8650574"
                }
            ], 
            "title": "The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.", 
            "journal": "Science", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Hood L., Koop B.F., Rowen L.", 
            "date": "1996"
        }
    ], 
    "uniprot_ac": "A0A5B6", 
    "site_annotation": [
        {
            "end_pos": 105, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 103
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6#A0A5B6-1", 
            "isoform_ac": "A0A5B6-1", 
            "locus": {
                "end_pos": 142761382, 
                "strand": "-", 
                "start_pos": 142761860, 
                "chromosome": "7", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENST00000619125", 
                        "id": "ENST00000619125", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSP00000480928", 
                        "id": "ENSP00000480928", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A0A5B6-1|TVB28_HUMAN Isoform 1 of T cell receptor beta variable 28  OS=Homo sapiens OX=9606 GN=TRBV28 PE=1 SV=1 CANONICAL=A0A5B6-1", 
                "length": 114, 
                "sequence": "MGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL"
            }
        }
    ], 
    "pathway": [], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6#function", 
            "annotation": "V region of the variable domain of T cell receptor (TR) beta chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NF-kappa-B (NF-kB) pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation (PubMed:23524462). The T cell repertoire is generated in the thymus, by V-(D)-J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity (PubMed:15040585).", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6#function", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }
            ]
        }
    ], 
    "orthologs": [], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [
        {
            "sequence_org": "N", 
            "alt_nt": "null", 
            "chr_id": "7", 
            "ref_nt": "T", 
            "chr_pos": "142721124A>", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778127163", 
                    "id": "rs778127163", 
                    "database": "dbSNP"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778127163", 
                    "id": "rs778127163", 
                    "database": "ExAC"
                }, 
                {
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs778127163", 
                    "id": "rs778127163", 
                    "database": "gnomAD"
                }
            ], 
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ], 
            "sequence_mut": "I", 
            "start_pos": 103, 
            "keywords": [
                "ebi", 
                "germline"
            ], 
            "end_pos": 103, 
            "minor_allelic_frequency": "", 
            "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->IQT)."
        }, 
        {
            "sequence_org": "N", 
            "alt_nt": "null", 
            "chr_id": "7", 
            "ref_nt": "G", 
            "chr_pos": "142721125C>", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747271807", 
                    "id": "rs747271807", 
                    "database": "dbSNP"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747271807", 
                    "id": "rs747271807", 
                    "database": "ExAC"
                }, 
                {
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs747271807", 
                    "id": "rs747271807", 
                    "database": "gnomAD"
                }
            ], 
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ], 
            "sequence_mut": "K", 
            "start_pos": 103, 
            "keywords": [
                "ebi", 
                "germline"
            ], 
            "end_pos": 103, 
            "minor_allelic_frequency": "", 
            "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->KQT)."
        }, 
        {
            "sequence_org": "N", 
            "alt_nt": "null", 
            "chr_id": "7", 
            "ref_nt": "G", 
            "chr_pos": "142721124A>", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778127163", 
                    "id": "rs778127163", 
                    "database": "dbSNP"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778127163", 
                    "id": "rs778127163", 
                    "database": "ExAC"
                }, 
                {
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs778127163", 
                    "id": "rs778127163", 
                    "database": "gnomAD"
                }
            ], 
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ], 
            "sequence_mut": "S", 
            "start_pos": 103, 
            "keywords": [
                "ebi", 
                "germline"
            ], 
            "end_pos": 103, 
            "minor_allelic_frequency": "", 
            "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT)."
        }, 
        {
            "sequence_org": "T", 
            "alt_nt": "null", 
            "chr_id": "7", 
            "ref_nt": "C", 
            "chr_pos": "142721129A>", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1468779716", 
                    "id": "rs1468779716", 
                    "database": "dbSNP"
                }, 
                {
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1468779716", 
                    "id": "rs1468779716", 
                    "database": "gnomAD"
                }
            ], 
            "glycoeffect": [
                "n-glyco-sequon-loss", 
                "o-glyco-site-loss"
            ], 
            "sequence_mut": "P", 
            "start_pos": 105, 
            "keywords": [
                "ebi", 
                "germline"
            ], 
            "end_pos": 105, 
            "minor_allelic_frequency": "", 
            "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->NQP)."
        }
    ], 
    "cluster_types": [], 
    "refseq": {}, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                                "id": "A0A5B6", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "plasma membrane", 
                        "id": "GO:0005886"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                                "id": "A0A5B6", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "T cell receptor complex", 
                        "id": "GO:0042101"
                    }
                ], 
                "total": 2, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                                "id": "A0A5B6", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cell surface receptor signaling pathway", 
                        "id": "GO:0007166"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A5B6", 
                                "id": "A0A5B6", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "adaptive immune response", 
                        "id": "GO:0002250"
                    }
                ], 
                "total": 2, 
                "name": "Biological Process"
            }
        ]
    }, 
    "gene_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "TCRBV3S1"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "TRBV28"
        }
    ], 
    "pro_annotation": [], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211753", 
            "id": "ENSG00000211753", 
            "database": "Bgee"
        }, 
        {
            "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A5B6", 
            "id": "A0A5B6", 
            "database": "BioMuta"
        }, 
        {
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TRBV28", 
            "id": "TRBV28", 
            "database": "GeneCards"
        }, 
        {
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12209", 
            "id": "12209", 
            "database": "HGNC"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", 
            "id": "IPR007110", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", 
            "id": "IPR013106", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", 
            "id": "IPR013783", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", 
            "id": "IPR036179", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.nextprot.org/entry/NX_A0A5B6", 
            "id": "NX_A0A5B6", 
            "database": "neXtProt"
        }, 
        {
            "url": "https://www.rcsb.org/structure/4ZDH", 
            "id": "4ZDH", 
            "database": "PDB"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF07686", 
            "id": "PF07686", 
            "database": "Pfam"
        }, 
        {
            "url": "http://purl.obolibrary.org/obo/PR_PR_A0A5B6", 
            "id": "PR_A0A5B6", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6", 
            "id": "A0A5B6", 
            "database": "UniProtKB"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [
        {
            "residue": "Asn", 
            "site_category": "reported", 
            "end_pos": 103, 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A5B6#ptm_processing", 
                    "id": "A0A5B6", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://prosite.expasy.org/rule/PRU00498", 
                    "id": "PRU00498", 
                    "database": "PROSITE-PRORULE"
                }
            ], 
            "subtype": "", 
            "relation": "attached", 
            "start_pos": 103, 
            "glytoucan_ac": "", 
            "type": "N-linked"
        }
    ], 
    "mutagenesis": [], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 13166.0, 
        "chemical_mass": 13166.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6", 
            "name": "TRBV28", 
            "locus": {
                "end_pos": 142721160, 
                "strand": "+", 
                "start_pos": 142720660, 
                "chromosome": "7", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSG00000211753", 
                        "id": "ENSG00000211753", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A5B6#names_and_taxonomy", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "T cell receptor beta variable 28"
        }
    ]
}