{ "uniprot_canonical_ac": "A0A1B0GSZ0-1", "ptm_annotation": [], "sequence": { "header": "sp|A0A1B0GSZ0-1|SPAR_MOUSE Isoform 1 of Small regulatory polypeptide of amino acid response OS=Mus musculus OX=10090 GN=Spaar PE=1 SV=1 CANONICAL=A0A1B0GSZ0-1", "length": 75, "sequence": "METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV" }, "uniprot_id": "SPAR_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28024296", "type": [ "PubMed" ], "id": "28024296" } ], "title": "mTORC1 and muscle regeneration are regulated by the LINC00961-encoded SPAR polypeptide.", "journal": "Nature", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037.1", "id": "NP_001335037.1", "database": "RefSeq" } ], "authors": "Yamashita R., Matsumoto A., Matsumoto M., Nakayama K.I., Saghatelian A., Pandolfi P.P., Clohessy J.G., Fung J., Monteleone E., Pasut A.", "date": "2017" } ], "uniprot_ac": "A0A1B0GSZ0", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0#A0A1B0GSZ0-1", "isoform_ac": "A0A1B0GSZ0-1", "locus": { "end_pos": 43730965, "strand": "-", "start_pos": 43731189, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000131248", "id": "ENSMUST00000131248", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000148128", "id": "ENSMUSP00000148128", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0A1B0GSZ0-1|SPAR_MOUSE Isoform 1 of Small regulatory polypeptide of amino acid response OS=Mus musculus OX=10090 GN=Spaar PE=1 SV=1 CANONICAL=A0A1B0GSZ0-1", "length": 75, "sequence": "METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71406", "resource": "KEGG Pathway", "id": "mmu:71406", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037.1", "annotation": "Data provide a mechanism by which mTORC1 activation may be finely regulated in a tissue-specific manner in response to injury, and a paradigm by which lncRNAs encoding small polypeptides like SPAR can modulate general biological pathways and processes to facilitate tissue-specific requirements, consistent with their restricted and highly regulated expression profile", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037.1", "id": "NP_001335037.1", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0#function", "annotation": "Negative regulator of amino acid sensing and mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels and amino acids (By similarity). Negatively regulates mTORC1 activation by inhibiting recruitment of mTORC1 to lysosomes upon stimulation with amino acids: acts by promoting the formation of a tightly bound supercomplex composed of the lysosomal V-ATPase, Ragulator and Rag GTPases, preventing recruitment of mTORC1 (By similarity). Acts as a regulator of muscle regeneration following injury by regulating mTORC1 activation (PubMed:28024296).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0#function", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ] } ], "orthologs": [], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037.1", "ac": "NP_001335037.1", "name": "small regulatory polypeptide of amino acid response", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "late endosome membrane", "id": "GO:0031902" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905103", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "integral component of lysosomal membrane", "id": "GO:1905103" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046611", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "lysosomal proton-transporting V-type ATPase complex", "id": "GO:0046611" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071230", "pmid": "28024296", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "cellular response to amino acid stimulus", "id": "GO:0071230" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043416", "pmid": "28024296", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "regulation of skeletal muscle tissue regeneration", "id": "GO:0043416" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904262", "pmid": "28024296", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "name": "negative regulation of TORC1 signaling", "id": "GO:1904262" } ], "total": 3, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A0A1B0GSZ0", "type": "synonym", "resource": "RefSeq", "name": "5430416O09Rik; AI481365; Spar" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0A1B0GSZ0", "type": "synonym", "resource": "RefSeq", "name": "Spaar" }, { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "type": "recommended", "resource": "UniProtKB", "name": "Spaar" }, { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "type": "synonym", "resource": "UniProtKB", "name": "Spar" } ], "pro_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/gene/71406", "id": "71406", "database": "GeneID" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71406", "id": "mmu:71406", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:1918656", "id": "1918656", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/FTVATFH/", "id": "FTVATFH", "database": "OMA" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A0A1B0GSZ0", "id": "PR_A0A1B0GSZ0", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335037.1", "id": "NP_001335037.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 8470.0, "chemical_mass": 8470.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "name": "Spaar", "locus": { "end_pos": 43759462, "strand": "+", "start_pos": 43730034, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000028475", "id": "ENSMUSG00000028475", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Small regulatory polypeptide of amino acid response" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0A1B0GSZ0", "type": "synonym", "resource": "RefSeq", "name": "small regulatory polypeptide of amino acid response" } ] }