{ "uniprot_canonical_ac": "A0A075B7F1-1", "ptm_annotation": [], "sequence": { "header": "tr|A0A075B7F1-1|A0A075B7F1_HUMAN Isoform 1 of Immunoglobulin heavy variable 3/OR16-8 (non-functional) OS=Homo sapiens OX=9606 GN=IGHV3OR16-8 PE=1 SV=1 CANONICAL=A0A075B7F1-1", "length": 116, "sequence": "MEFGLNWVFLVAIIKGAQCEVQLVESGGGLVQPGGSLRLSCPASGFTFSNHYMSWVRQAPGKGLEWVSYISGDSGYTNYADSVKGRFTISRDNANNSPYLQMNSLRAEDTAVYYCV" }, "uniprot_id": "A0A075B7F1_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [ "glycoprotein", "reported_with_glycan.glyconnect" ], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/29741879", "type": [ "PubMed" ], "id": "29741879" } ], "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "evidence": [ { "url": "https://glyconnect.expasy.org/browser/proteins/1661", "id": "1661", "database": "GlyConnect" } ], "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "date": "2018" } ], "uniprot_ac": "A0A075B7F1", "site_annotation": [ { "end_pos": 97, "annotation": "n_glycosylation_sequon", "start_pos": 95 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1#A0A075B7F1-1", "isoform_ac": "A0A075B7F1-1", "locus": { "end_pos": 33009175, "strand": "-", "start_pos": 33009619, "chromosome": "16", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000565407", "id": "ENST00000565407", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000474964", "id": "ENSP00000474964", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A075B7F1-1|A0A075B7F1_HUMAN Isoform 1 of Immunoglobulin heavy variable 3/OR16-8 (non-functional) OS=Homo sapiens OX=9606 GN=IGHV3OR16-8 PE=1 SV=1 CANONICAL=A0A075B7F1-1", "length": 116, "sequence": "MEFGLNWVFLVAIIKGAQCEVQLVESGGGLVQPGGSLRLSCPASGFTFSNHYMSWVRQAPGKGLEWVSYISGDSGYTNYADSVKGRFTISRDNANNSPYLQMNSLRAEDTAVYYCV" } } ], "pathway": [], "function": [], "orthologs": [], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "Q", "start_pos": 22, "alt_nt": "C", "chr_id": "16", "ref_nt": "G", "chr_pos": "33020658", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:1324", "url": "http://disease-ontology.org/term/DOID:1324", "resource": "Disease Ontology", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.6", "sequence_mut": "H", "subjects_tested": "1514", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 2 out of 6 filters: patient freq. (1.6%); patient count (24/1514).", "end_pos": 22, "minor_allelic_frequency": "", "subjects_positive": "24" }, { "sequence_org": "N", "start_pos": 95, "alt_nt": "G", "chr_id": "16", "ref_nt": "T", "chr_pos": "33020877", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370645488", "id": "rs370645488", "database": "dbSNP" }, { "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs370645488", "id": "rs370645488", "database": "1000Genomes" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370645488", "id": "rs370645488", "database": "ExAC" }, { "url": "https://www.ncbi.nlm.nih.gov/snp/rs370645488#frequency_tab", "id": "rs370645488", "database": "TOPMed" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs370645488", "id": "rs370645488", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "frequency": "6.0", "sequence_mut": "K", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "annotation": "Somatic mutation passed 2 out of 6 filters: patient freq. (6.0%); n-glyco-sequon-loss (NNS->KNS).", "end_pos": 95, "minor_allelic_frequency": "", "subjects_positive": "3" }, { "sequence_org": "N", "start_pos": 95, "alt_nt": "G", "chr_id": "16", "ref_nt": "A", "chr_pos": "33020876", "disease": [ { "synonyms": [ { "id": "DOID:263", "url": "http://disease-ontology.org/term/DOID:263", "resource": "Disease Ontology", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "url": "http://disease-ontology.org/term/DOID:263", "resource": "Disease Ontology", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "url": "http://disease-ontology.org/term/DOID:263", "resource": "Disease Ontology", "name": "renal cancer", "description": "" } ], "recommended_name": { "id": "DOID:263", "url": "http://disease-ontology.org/term/DOID:263", "resource": "Disease Ontology", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357753418", "id": "rs1357753418", "database": "dbSNP" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357753418", "id": "rs1357753418", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "frequency": "0.2", "sequence_mut": "S", "subjects_tested": "655", "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNS->SNS); n-glyco-sequon-gain (NAN->NAS).", "end_pos": 95, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "L", "start_pos": 105, "alt_nt": "C", "chr_id": "16", "ref_nt": "T", "chr_pos": "33020906", "disease": [ { "synonyms": [ { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "tumor of the Ovary", "description": "" } ], "recommended_name": { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.1", "sequence_mut": "P", "subjects_tested": "93", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "end_pos": 105, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "T", "start_pos": 47, "alt_nt": "A", "chr_id": "16", "ref_nt": "C", "chr_pos": "33020732", "disease": [ { "synonyms": [ { "id": "DOID:10534", "url": "http://disease-ontology.org/term/DOID:10534", "resource": "Disease Ontology", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "url": "http://disease-ontology.org/term/DOID:10534", "resource": "Disease Ontology", "name": "gastric neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:10534", "url": "http://disease-ontology.org/term/DOID:10534", "resource": "Disease Ontology", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892529943", "id": "rs892529943", "database": "dbSNP" }, { "url": "https://www.ncbi.nlm.nih.gov/snp/rs892529943#frequency_tab", "id": "rs892529943", "database": "TOPMed" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs892529943", "id": "rs892529943", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "frequency": "0.1", "sequence_mut": "N", "subjects_tested": "1044", "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TFS->NFS).", "end_pos": 47, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "A", "start_pos": 80, "alt_nt": "T", "chr_id": "16", "ref_nt": "G", "chr_pos": "33020830", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:1324", "url": "http://disease-ontology.org/term/DOID:1324", "resource": "Disease Ontology", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "frequency": "0.1", "sequence_mut": "S", "subjects_tested": "689", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NYA->NYS).", "end_pos": 80, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "A", "alt_nt": "null", "chr_id": "16", "ref_nt": "A", "chr_pos": "33009509G>", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373565926", "id": "rs373565926", "database": "dbSNP" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373565926", "id": "rs373565926", "database": "ExAC" }, { "url": "https://www.ncbi.nlm.nih.gov/snp/rs373565926#frequency_tab", "id": "rs373565926", "database": "TOPMed" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs373565926", "id": "rs373565926", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "sequence_mut": "T", "start_pos": 80, "keywords": [ "ebi", "germline" ], "end_pos": 80, "minor_allelic_frequency": "", "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYA->NYT)." }, { "sequence_org": "P", "start_pos": 98, "alt_nt": "A", "chr_id": "16", "ref_nt": "C", "chr_pos": "33020884", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:1324", "url": "http://disease-ontology.org/term/DOID:1324", "resource": "Disease Ontology", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "frequency": "0.3", "sequence_mut": "T", "subjects_tested": "689", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NSP->NST).", "end_pos": 98, "minor_allelic_frequency": "", "subjects_positive": "2" } ], "cluster_types": [], "refseq": {}, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034987", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "immunoglobulin receptor binding", "id": "GO:0034987" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "antigen binding", "id": "GO:0003823" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "external side of plasma membrane", "id": "GO:0009897" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042571", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "immunoglobulin complex, circulating", "id": "GO:0042571" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006911", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "phagocytosis, engulfment", "id": "GO:0006911" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "innate immune response", "id": "GO:0045087" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "B cell receptor signaling pathway", "id": "GO:0050853" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "defense response to bacterium", "id": "GO:0042742" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006910", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "phagocytosis, recognition", "id": "GO:0006910" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050871", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "positive regulation of B cell activation", "id": "GO:0050871" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "name": "complement activation, classical pathway", "id": "GO:0006958" } ], "total": 7, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "type": "recommended", "resource": "UniProtKB", "name": "IGHV3OR16-8" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000271130", "id": "ENSG00000271130", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7F1", "id": "A0A075B7F1", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHV3OR16-8", "id": "IGHV3OR16-8", "database": "GeneCards" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5643", "id": "5643", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "id": "IPR007110", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "id": "IPR013106", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "id": "IPR013783", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "id": "IPR036179", "database": "InterPro" }, { "url": "https://omabrowser.org/oma/group/IWIRQAP/", "id": "IWIRQAP", "database": "OMA" }, { "url": "http://pfam.xfam.org/family/PF07686", "id": "PF07686", "database": "Pfam" }, { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "id": "A0A075B7F1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [ { "residue": "Asn", "site_category": "reported_with_glycan", "end_pos": 95, "evidence": [ { "url": "https://glyconnect.expasy.org/browser/proteins/1661", "id": "1661", "database": "GlyConnect" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/29741879", "id": "29741879", "database": "PubMed" } ], "subtype": "", "relation": "attached", "start_pos": 95, "glytoucan_ac": "G91473PK", "type": "N-linked" } ], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 12703.0, "chemical_mass": 12703.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1", "name": "IGHV3OR16-8", "locus": { "end_pos": 33009620, "strand": "+", "start_pos": 33009175, "chromosome": "16", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000271130", "id": "ENSG00000271130", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7F1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Immunoglobulin heavy variable 3/OR16-8 (non-functional)" } ] }