{ "uniprot_canonical_ac": "A0A075B6N2-1", "ptm_annotation": [], "sequence": { "header": "sp|A0A075B6N2-1|TVBT1_HUMAN Isoform 1 of T cell receptor beta variable 20-1 OS=Homo sapiens OX=9606 GN=TRBV20-1 PE=3 SV=1 CANONICAL=A0A075B6N2-1", "length": 111, "sequence": "MLLLLLLLGPGSGLGAVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR" }, "uniprot_id": "TVBT1_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/15040585", "type": [ "PubMed" ], "id": "15040585" } ], "title": "The many important facets of T-cell repertoire diversity.", "journal": "Nat. Rev. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "authors": "Messaoudi I., Nikolich-Zugich J., Slifka M.K.", "date": "2004" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20452950", "type": [ "PubMed" ], "id": "20452950" } ], "title": "Structural biology of the T-cell receptor: insights into receptor assembly, ligand recognition, and initiation of signaling.", "journal": "Cold Spring Harb. Perspect. Biol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "authors": "Gagnon E., Wucherpfennig K.W., Call M.E., Call M.J., Huseby E.S.", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23524462", "type": [ "PubMed" ], "id": "23524462" } ], "title": "T cell receptor signalling networks: branched, diversified and bounded.", "journal": "Nat. Rev. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "authors": "Zamoyska R., Brownlie R.J.", "date": "2013" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/24600447", "type": [ "PubMed" ], "id": "24600447" } ], "title": "Immunoglobulin and T Cell Receptor Genes: IMGT((R)) and the Birth and Rise of Immunoinformatics.", "journal": "Front. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "authors": "Lefranc M.P.", "date": "2014" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25493333", "type": [ "PubMed" ], "id": "25493333" } ], "title": "T cell antigen receptor recognition of antigen-presenting molecules.", "journal": "Annu. Rev. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "authors": "Rossjohn J., Gras S., McCluskey J., Godfrey D.I., Miles J.J., Turner S.J.", "date": "2015" } ], "uniprot_ac": "A0A075B6N2", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2#A0A075B6N2-1", "isoform_ac": "A0A075B6N2-1", "locus": { "end_pos": 142626727, "strand": "-", "start_pos": 142627397, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000390394", "id": "ENST00000390394", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000374917", "id": "ENSP00000374917", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0A075B6N2-1|TVBT1_HUMAN Isoform 1 of T cell receptor beta variable 20-1 OS=Homo sapiens OX=9606 GN=TRBV20-1 PE=3 SV=1 CANONICAL=A0A075B6N2-1", "length": 111, "sequence": "MLLLLLLLGPGSGLGAVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR" } }, { "url": "https://www.uniprot.org/uniprot/A0A075B6N2#A0A5B4-1", "isoform_ac": "A0A5B4-1", "locus": { "end_pos": 142668509, "strand": "-", "start_pos": 142669179, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000633466", "id": "ENST00000633466", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000488099", "id": "ENSP00000488099", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A5B4-1|TVBT1_HUMAN Computationally mapped isoform of T cell receptor beta variable 20-1 OS=Homo sapiens OX=9606 GN=TRBV20-1 PE=3 SV=1 CANONICAL=A0A075B6N2-1", "length": 111, "sequence": "MLLLLLLLGPGSGLGAVVSQHPSWVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR" } } ], "pathway": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2#function", "annotation": "V region of the variable domain of T cell receptor (TR) beta chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NF-kappa-B (NF-kB) pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation (PubMed:23524462). The T cell repertoire is generated in the thymus, by V-(D)-J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity (PubMed:15040585).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2#function", "id": "A0A075B6N2", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0B4J1H5-1", "protein_name": "T cell receptor beta, variable 20", "sequence": { "length": 111, "sequence": "MLLLLLLLGPGCGLGALVYQYPRRTICKSGTSMRMECQAVGFQATSVAWYRQSPQKTFELIALSTVNSAIKYEQNFTQEKFPISHPNLSFSSMTVLNAYLEDRGLYLCGAR" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A0A075B6N2/", "id": "A0A075B6N2", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Trbv20", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "E", "start_pos": 77, "alt_nt": "A", "chr_id": "7", "ref_nt": "G", "chr_pos": "142334807", "disease": [ { "synonyms": [ { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "recommended_name": { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." } }, { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } }, { "synonyms": [ { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "tumor of the Brain", "description": "" } ], "recommended_name": { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." } }, { "synonyms": [ { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "primary breast cancer", "description": "" } ], "recommended_name": { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B6N2", "id": "A0A075B6N2", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "0.1", "sequence_mut": "K", "subjects_tested": "820", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "end_pos": 77, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": {}, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "name": "T cell receptor complex", "id": "GO:0042101" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "name": "cell surface receptor signaling pathway", "id": "GO:0007166" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "name": "adaptive immune response", "id": "GO:0002250" } ], "total": 2, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "type": "recommended", "resource": "UniProtKB", "name": "TRBV20-1" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211747", "id": "ENSG00000211747", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B6N2", "id": "A0A075B6N2", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TRBV20-1", "id": "TRBV20-1", "database": "GeneCards" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12196", "id": "12196", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "id": "IPR007110", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "id": "IPR013106", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "id": "IPR013783", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "id": "IPR036179", "database": "InterPro" }, { "url": "https://www.nextprot.org/entry/NX_A0A075B6N2", "id": "NX_A0A075B6N2", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/TTMFWYH/", "id": "TTMFWYH", "database": "OMA" }, { "url": "http://pfam.xfam.org/family/PF07686", "id": "PF07686", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A0A075B6N2", "id": "PR_A0A075B6N2", "database": "PRO" }, { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "id": "A0A075B6N2", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 12175.0, "chemical_mass": 12175.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2", "name": "TRBV20-1", "locus": { "end_pos": 142627399, "strand": "+", "start_pos": 142626649, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000211747", "id": "ENSG00000211747", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0A075B6N2#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "T cell receptor beta variable 20-1" } ] }