{ "uniprot_canonical_ac": "A2RUC4-1", "ptm_annotation": [], "sequence": { "header": "sp|A2RUC4-1|TYW5_HUMAN Isoform 1 of tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1 CANONICAL=A2RUC4-1", "length": 315, "sequence": "MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE" }, "uniprot_id": "TYW5_HUMAN", "enzyme_annotation": [ { "ec": "1.14.11.42", "activity": "" }, { "ec": "1.14.11.42", "activity": "7-(3-amino-3-carboxypropyl)wyosine(37) in tRNA(Phe) + 2-oxoglutarate + O(2) = 7-(2-hydroxy-3-amino-3-carboxypropyl)wyosine(37) in tRNA(Phe) + succinate + CO(2)." } ], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20739293", "type": [ "PubMed" ], "id": "20739293" } ], "title": "Expanding role of the jumonji C domain as an RNA hydroxylase.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034782.1", "id": "NP_001034782.1", "database": "RefSeq" } ], "authors": "Suzuki T., Nagao A., Kato M., Nureki O., Ishitani R., Noma A.", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20972222", "type": [ "PubMed" ], "id": "20972222" } ], "title": "Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.", "journal": "Nucleic Acids Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034782.1", "id": "NP_001034782.1", "database": "RefSeq" } ], "authors": "Suzuki T., Nagao A., Kato M., Nureki O., Ishitani R., Noma A., Araiso Y.", "date": "2011" } ], "uniprot_ac": "A2RUC4", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4#A2RUC4-1", "isoform_ac": "A2RUC4-1", "locus": { "end_pos": 199933070, "strand": "+", "start_pos": 199955470, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000354611", "id": "ENST00000354611", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000346627", "id": "ENSP00000346627", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2RUC4-1|TYW5_HUMAN Isoform 1 of tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1 CANONICAL=A2RUC4-1", "length": 315, "sequence": "MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE" } }, { "url": "https://www.uniprot.org/uniprot/A2RUC4#A2RUC4-2", "isoform_ac": "A2RUC4-2", "locus": {}, "sequence": { "header": "sp|A2RUC4-2|TYW5_HUMAN Isoform 2 of tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1 CANONICAL=A2RUC4-1", "length": 152, "sequence": "MDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE" } }, { "url": "https://www.uniprot.org/uniprot/A2RUC4#A8KAJ9-1", "isoform_ac": "A8KAJ9-1", "locus": { "end_pos": 199939037, "strand": "+", "start_pos": 199955470, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000441832", "id": "ENST00000441832", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000398447", "id": "ENSP00000398447", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A8KAJ9-1|TYW5_HUMAN Computationally mapped isoform of tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1 CANONICAL=A2RUC4-1", "length": 121, "sequence": "MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFIKLYLLTSWSRGQLKRNIKNSLFQRMRNTTYGHLEKTLERMLQISESSFLC" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:129450", "resource": "KEGG Pathway", "id": "hsa:129450", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782861", "resource": "Reactome", "id": "R-HSA-6782861", "name": "Synthesis of wybutosine at G37 of tRNA(Phe)" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4#function", "annotation": "tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4#function", "id": "A2RUC4", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A2RSX7-1", "protein_name": "tRNA wybutosine-synthesizing protein 5", "sequence": { "length": 315, "sequence": "MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVPQMDFISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILDRALKTLAELPEEYRDFYARQMVLRIQDKAYSKNFE" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/72085", "id": "72085", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2RUC4/", "id": "A2RUC4", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "D3ZY75-1", "protein_name": "tRNA-yW synthesizing protein 5", "sequence": { "length": 315, "sequence": "MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVAQMDFISKNFVYRTLPFNKLVQRAAEETHKEFFISQDERYYLRSLGEDPRKDIADIRQQFPSLGEDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFSPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNVFLKHLPSECYDTTDTYGNKDPVAASRAMQILDRALKTLAELPEEYRDFYARQMVLRIQDKAYSKNSE" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/72085", "id": "72085", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2RUC4/", "id": "A2RUC4", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "K", "start_pos": 139, "alt_nt": "C", "chr_id": "2", "ref_nt": "T", "chr_pos": "200803727", "disease": [ { "synonyms": [ { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "malignant hematopoietic neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RUC4", "id": "A2RUC4", "database": "BioMuta" } ], "glycoeffect": [ "o-glyco-sequon-loss" ], "frequency": "2.1", "sequence_mut": "E", "subjects_tested": "48", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.1%).", "end_pos": 139, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 149, "alt_nt": "T", "chr_id": "2", "ref_nt": "C", "chr_pos": "200803696", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:9256", "url": "http://disease-ontology.org/term/DOID:9256", "resource": "Disease Ontology", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RUC4", "id": "A2RUC4", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.1", "sequence_mut": "Q", "subjects_tested": "94", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%). In dbSNP: rs372920812.", "end_pos": 149, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "W", "start_pos": 158, "alt_nt": "A", "chr_id": "2", "ref_nt": "C", "chr_pos": "200803668", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RUC4", "id": "A2RUC4", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "C", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 158, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "V", "start_pos": 163, "alt_nt": "A", "chr_id": "2", "ref_nt": "C", "chr_pos": "200801215", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RUC4", "id": "A2RUC4", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "L", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 163, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "D", "start_pos": 225, "alt_nt": "C", "chr_id": "2", "ref_nt": "T", "chr_pos": "200800671", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RUC4", "id": "A2RUC4", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "G", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 225, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034782.1", "ac": "NP_001034782.1", "name": "tRNA wybutosine-synthesizing protein 5", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "pmid": "20972222", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "iron ion binding", "id": "GO:0005506" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "pmid": "20972222", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "protein homodimerization activity", "id": "GO:0042803" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000049", "pmid": "20972222", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "tRNA binding", "id": "GO:0000049" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016706", "pmid": "20972222", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "2-oxoglutarate-dependent dioxygenase activity", "id": "GO:0016706" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016706", "pmid": "20739293", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "2-oxoglutarate-dependent dioxygenase activity", "id": "GO:0016706" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102524", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "tRNAPhe (7-(3-amino-3-carboxypropyl)wyosine37-C2)-hydroxylase activity", "id": "GO:0102524" } ], "total": 6, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031591", "pmid": "20972222", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "wybutosine biosynthetic process", "id": "GO:0031591" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031591", "pmid": "20739293", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "wybutosine biosynthetic process", "id": "GO:0031591" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006400", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "name": "tRNA modification", "id": "GO:0006400" } ], "total": 3, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RUC4", "type": "synonym", "resource": "RefSeq", "name": "C2orf60; hTYW5" }, { "url": "https://www.uniprot.org/uniprot/A2RUC4", "type": "synonym", "resource": "UniProtKB", "name": "C2orf60" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RUC4", "type": "synonym", "resource": "RefSeq", "name": "TYW5" }, { "url": "https://www.uniprot.org/uniprot/A2RUC4", "type": "recommended", "resource": "UniProtKB", "name": "TYW5" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RUC4", "id": "A2RUC4", "database": "BioMuta" }, { "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.11.42&UniProtAcc=A2RUC4", "id": "1.14.11.42", "database": "BRENDA" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TYW5", "id": "TYW5", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/129450", "id": "129450", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26754", "id": "26754", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A2RUC4*", "id": "A2RUC4", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003347", "id": "IPR003347", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029612", "id": "IPR029612", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR041667", "id": "IPR041667", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:129450", "id": "hsa:129450", "database": "KEGG Pathway" }, { "url": "https://www.nextprot.org/entry/NX_A2RUC4", "id": "NX_A2RUC4", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/PLYDDRP/", "id": "PLYDDRP", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1385616at2759", "id": "1385616at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12461:SF50", "id": "PTHR12461:SF50", "database": "PANTHER" }, { "url": "https://www.rcsb.org/structure/3AL5", "id": "3AL5", "database": "PDB" }, { "url": "https://www.rcsb.org/structure/3AL6", "id": "3AL6", "database": "PDB" }, { "url": "http://pfam.xfam.org/family/PF13621", "id": "PF13621", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A2RUC4", "id": "A2RUC4", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2RUC4", "id": "PR_A2RUC4", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782861", "id": "R-HSA-6782861", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034782.1", "id": "NP_001034782.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RUC4", "id": "A2RUC4", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [ { "sequence_org": "R", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20972222", "id": "20972222", "database": "PubMed" } ], "sequence_mut": "A", "start_pos": 108, "end_pos": 108, "annotation": "Abolishes enzyme activity and ability to bind tRNA." }, { "sequence_org": "R", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "id": "A2RUC4", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20972222", "id": "20972222", "database": "PubMed" } ], "sequence_mut": "A", "start_pos": 149, "end_pos": 149, "annotation": "Abolishes enzyme activity and ability to bind tRNA." } ], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 36548.0, "chemical_mass": 36548.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162971", "id": "ENSG00000162971", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "name": "TYW5", "locus": { "end_pos": 199929975, "strand": "-", "start_pos": 199955736, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000162971", "id": "ENSG00000162971", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2RUC4", "type": "synonym", "resource": "UniProtKB", "name": "1.14.11.42" }, { "url": "https://www.uniprot.org/uniprot/A2RUC4", "type": "synonym", "resource": "UniProtKB", "name": "hTYW5" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RUC4", "type": "synonym", "resource": "RefSeq", "name": "tRNA wybutosine-synthesizing protein 5" }, { "url": "https://www.uniprot.org/uniprot/A2RUC4", "type": "recommended", "resource": "UniProtKB", "name": "tRNA wybutosine-synthesizing protein 5" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RUC4", "type": "synonym", "resource": "RefSeq", "name": "tRNA yW-synthesizing enzyme 5; jmjC domain-containing protein C2orf60; tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase" }, { "url": "https://www.uniprot.org/uniprot/A2RUC4", "type": "synonym", "resource": "UniProtKB", "name": "tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase" } ] }