{ "uniprot_canonical_ac": "A2AM29-1", "ptm_annotation": [], "sequence": { "header": "sp|A2AM29-1|AF9_MOUSE Isoform 1 of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 569, "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" }, "uniprot_id": "AF9_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12242306", "type": [ "PubMed" ], "id": "12242306" } ], "title": "Mouse Af9 is a controller of embryo patterning, like Mll, whose human homologue fuses with Af9 after chromosomal translocation in leukemia.", "journal": "Molecular and cellular biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Collins EC, Appert A, Ariza-McNaughton L, Pannell R, Yamada Y, Rabbitts TH", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27626380", "type": [ "PubMed" ], "id": "27626380" } ], "title": "High-throughput discovery of novel developmental phenotypes.", "journal": "Nature", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bucan M, Murray SA", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27105114", "type": [ "PubMed" ], "id": "27105114" } ], "title": "Molecular Coupling of Histone Crotonylation and Active Transcription by AF9 YEATS Domain.", "journal": "Molecular cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Li Y, Sabari BR, Panchenko T, Wen H, Zhao D, Guan H, Wan L, Huang H, Tang Z, Zhao Y, Roeder RG, Shi X, Allis CD, Li H", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27607576", "type": [ "PubMed" ], "id": "27607576" } ], "title": "Atg5-dependent autophagy contributes to the development of acute myeloid leukemia in an MLL-AF9-driven mouse model.", "journal": "Cell death & disease", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Liu Q, Chen L, Atkinson JM, Claxton DF, Wang HG", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11439343", "type": [ "PubMed" ], "id": "11439343" } ], "title": "The polycomb protein MPc3 interacts with AF9, an MLL fusion partner in t(9;11)(p22;q23) acute leukemias.", "journal": "Oncogene", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "authors": "Gould G.C.D., Hemenway C.S., de Erkenez A.C.", "date": "2001" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27071307", "type": [ "PubMed" ], "id": "27071307" } ], "title": "Rheb1 promotes tumor progression through mTORC1 in MLL-AF9-initiated murine acute myeloid leukemia.", "journal": "Journal of hematology & oncology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Gao Y, Gao J, Li M, Zheng Y, Wang Y, Zhang H, Wang W, Chu Y, Wang X, Xu M, Cheng T, Ju Z, Yuan W", "date": "2016" } ], "uniprot_ac": "A2AM29", "site_annotation": [ { "end_pos": 543, "annotation": "n_glycosylation_sequon", "start_pos": 541 }, { "end_pos": 228, "annotation": "n_glycosylation_sequon", "start_pos": 226 }, { "end_pos": 365, "annotation": "n_glycosylation_sequon", "start_pos": 363 }, { "end_pos": 430, "annotation": "n_glycosylation_sequon", "start_pos": 428 }, { "end_pos": 372, "annotation": "n_glycosylation_sequon", "start_pos": 370 }, { "end_pos": 145, "annotation": "n_glycosylation_sequon", "start_pos": 143 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AM29#E9PXP8-1", "isoform_ac": "E9PXP8-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 87782319, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000148059", "id": "ENSMUST00000148059", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000131095", "id": "ENSMUSP00000131095", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9PXP8-1|AF9_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 54, "sequence": "MTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#A2AM29-1", "isoform_ac": "A2AM29-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 88033095, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000078090", "id": "ENSMUST00000078090", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000077232", "id": "ENSMUSP00000077232", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AM29-1|AF9_MOUSE Isoform 1 of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 569, "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#Q9D2P1-1", "isoform_ac": "Q9D2P1-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 87791965, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000126353", "id": "ENSMUST00000126353", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000129523", "id": "ENSMUSP00000129523", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|Q9D2P1-1|AF9_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 138, "sequence": "MKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#Q3UIA3-1", "isoform_ac": "Q3UIA3-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 87791965, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000149357", "id": "ENSMUST00000149357", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000128366", "id": "ENSMUSP00000128366", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|Q3UIA3-1|AF9_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 162, "sequence": "MKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#E9Q3B8-1", "isoform_ac": "E9Q3B8-1", "locus": { "end_pos": 88011673, "strand": "+", "start_pos": 88032639, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000142454", "id": "ENSMUST00000142454", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000127376", "id": "ENSMUSP00000127376", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9Q3B8-1|AF9_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 73, "sequence": "MCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRAWTEWRWLRSGC" } } ], "pathway": [ { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112382", "resource": "Reactome", "id": "R-MMU-112382", "name": "Formation of RNA Pol II elongation complex" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-674695", "resource": "Reactome", "id": "R-MMU-674695", "name": "RNA Polymerase II Pre-transcription Events" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75955", "resource": "Reactome", "id": "R-MMU-75955", "name": "RNA Polymerase II Transcription Elongation" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70122", "resource": "KEGG Pathway", "id": "mmu:70122", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "YEATS domain of AF9 directly links histone crotonylation to active transcription.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "Data suggest that RAS-homolog enriched in brain protein (Rheb1) promotes MLL-AF9 fusion protein initiated acute myeloid leukemia (AML) progression through target of rapamycin complex 1 (mTORC1) signaling pathway. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "Atg5-dependent autophagy contributes to the development of acute myeloid leukemia in an MLL-AF9-driven mouse model. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "Af9 gene is required for normal embryogenesis in mice by controlling pattern formation, apparently via control of Hox gene regulation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A2AM29#function", "annotation": "Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Specifically recognizes and binds acylated histone H3, with a marked preference for histone H3 that is crotonylated. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr), and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr). Also recognizes and binds histone H3 acetylated at 'Lys-9' (H3K9ac), but with lower affinity than crotonylated histone H3. In the SEC complex, MLLT3 is required to recruit the complex to crotonylated histones.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29#function", "id": "A2AM29", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2QC34-1", "protein_name": "MLLT3, super elongation complex subunit", "sequence": { "length": 500, "sequence": "MIVFMKRSSKPLLPSHHCLSVLQEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSAQQDKKAPSKRPPVSDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AM29/", "id": "A2AM29", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "P42568-1", "protein_name": "Protein AF-9", "sequence": { "length": 568, "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/37933", "id": "37933", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2AM29/", "id": "A2AM29", "database": "OMA" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "ac": "NP_081602.3", "name": "protein AF-9 isoform 1", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "chromatin binding", "id": "GO:0003682" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "histone binding", "id": "GO:0042393" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070577", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "lysine-acetylated histone binding", "id": "GO:0070577" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140030", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "modification-dependent protein binding", "id": "GO:0140030" } ], "total": 4, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008023", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "transcription elongation factor complex", "id": "GO:0008023" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "chromosome", "id": "GO:0005694" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009952", "pmid": "12242306", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "anterior/posterior pattern specification", "id": "GO:0009952" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007379", "pmid": "12242306", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "segment specification", "id": "GO:0007379" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "positive regulation of transcription, DNA-templated", "id": "GO:0045893" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000096", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "positive regulation of Wnt signaling pathway, planar cell polarity pathway", "id": "GO:2000096" } ], "total": 5, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "type": "recommended", "resource": "UniProtKB", "name": "Mllt3" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "2210011H10Rik; 2610012I03Rik; 3830408D16Rik; Af9; D4Ertd321e" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "Mllt3" }, { "url": "https://www.uniprot.org/uniprot/A2AM29", "type": "synonym", "resource": "UniProtKB", "name": "Af9" } ], "crossref": [ { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2AM29", "id": "PR_A2AM29", "database": "PRO" }, { "url": "http://www.informatics.jax.org/marker/MGI:1917372", "id": "1917372", "database": "MGI" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75955", "id": "R-MMU-75955", "database": "Reactome" }, { "url": "http://www.orthodb.org/?query=727038at2759", "id": "727038at2759", "database": "OrthoDB" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70122", "id": "mmu:70122", "database": "KEGG Pathway" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/70122", "id": "70122", "database": "GeneID" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-674695", "id": "R-MMU-674695", "database": "Reactome" }, { "url": "http://pfam.xfam.org/family/PF17793", "id": "PF17793", "database": "Pfam" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR005033", "id": "IPR005033", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF03366", "id": "PF03366", "database": "Pfam" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A2AM29*", "id": "A2AM29", "database": "IntAct" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028496", "id": "ENSMUSG00000028496", "database": "Bgee" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112382", "id": "R-MMU-112382", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR038704", "id": "IPR038704", "database": "InterPro" }, { "url": "https://omabrowser.org/oma/group/PNRSVHT/", "id": "PNRSVHT", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR040930", "id": "IPR040930", "database": "InterPro" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23195", "id": "PTHR23195", "database": "PANTHER" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "position": "413", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" }, { "residue": "Ser", "position": "420", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" }, { "residue": "Ser", "position": "295", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" }, { "residue": "Ser", "position": "413", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21183079", "id": "21183079", "database": "PubMed" } ], "kinase_uniprot_canonical_ac": "Q3UD01-1", "kinase_gene_name": "Atxn7l3b" }, { "residue": "Ser", "position": "484", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" }, { "residue": "Ser", "position": "289", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" } ], "mass": { "monoisotopic_mass": 63375.0, "chemical_mass": 63375.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "name": "Mllt3", "locus": { "end_pos": 87769925, "strand": "-", "start_pos": 88033364, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000028496", "id": "ENSMUSG00000028496", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "type": "recommended", "resource": "UniProtKB", "name": "Protein AF-9" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "protein AF-9; myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog; myeloid/lymphoid or mixed lineage-leukemia translocation to 3 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "protein AF-9 isoform 1" }, { "url": "https://www.uniprot.org/uniprot/A2AM29", "type": "synonym", "resource": "UniProtKB", "name": "lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog" } ] }