{ "uniprot_canonical_ac": "A2AJB7-1", "ptm_annotation": [ { "annotation": "2 different forms with differently processed N-termini exist.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ] } ], "sequence": { "header": "sp|A2AJB7-1|LCN5_MOUSE Isoform 1 of Epididymal-specific lipocalin-5 OS=Mus musculus OX=10090 GN=Lcn5 PE=1 SV=1 CANONICAL=A2AJB7-1", "length": 192, "sequence": "MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI" }, "uniprot_id": "LCN5_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/14595821", "type": [ "PubMed" ], "id": "14595821" } ], "title": "Profiling and imaging proteins in the mouse epididymis by imaging mass spectrometry.", "journal": "Proteomics", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "authors": "Caprioli R.M., Orgebin-Crist M.-C., Chaurand P., DaGue B.B., Fouchecourt S., Reyzer M.L., Xu B.J.", "date": "2003" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/9669522", "type": [ "PubMed" ], "id": "9669522" } ], "title": "Genomic organization and chromosomal localization of the murine epididymal retinoic acid-binding protein (mE-RABP) gene.", "journal": "Mol. Reprod. Dev.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ], "authors": "Mattei M.-G., Matusik R.J., Lareyre J.-J., Orgebin-Crist M.-C., Kasper S., Ong D.E.", "date": "1998" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/2393684", "type": [ "PubMed" ], "id": "2393684" } ], "title": "Secretion and transport of mouse epididymal proteins after injection of 35S-methionine.", "journal": "Biol. Reprod.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ], "authors": "Cornwall G.A., Orgebin-Crist M.-C., Vreeburg J.T.M., Holland M.K.", "date": "1990" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/1591333", "type": [ "PubMed" ], "id": "1591333" } ], "title": "The 18-kDa mouse epididymal protein (MEP 10) binds retinoic acid.", "journal": "Biol. Reprod.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "authors": "Orgebin-Crist M.-C., Ong D.E., Rankin T.L.", "date": "1992" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/1591332", "type": [ "PubMed" ], "id": "1591332" } ], "title": "Isolation, immunolocalization, and sperm-association of three proteins of 18, 25, and 29 kilodaltons secreted by the mouse epididymis.", "journal": "Biol. Reprod.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "authors": "Griswold M.D., Orgebin-Crist M.-C., Holland M.K., Rankin T.L., Tsuruta K.J.", "date": "1992" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16740652", "type": [ "PubMed" ], "id": "16740652" } ], "title": "The role of forkhead box A2 to restrict androgen-regulated gene expression of lipocalin 5 in the mouse epididymis.", "journal": "Molecular endocrinology (Baltimore, Md.)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ], "authors": "Yu X, Suzuki K, Wang Y, Gupta A, Jin R, Orgebin-Crist MC, Matusik R", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22574224", "type": [ "PubMed" ], "id": "22574224" } ], "title": "Retinoid-binding proteins: similar protein architectures bind similar ligands via completely different ways.", "journal": "PloS one", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ], "authors": "Zhang YR, Zhao YQ, Huang JF", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/9607808", "type": [ "PubMed" ], "id": "9607808" } ], "title": "Molecular cloning and hormonal regulation of a murine epididymal retinoic acid-binding protein messenger ribonucleic acid.", "journal": "Endocrinology", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ], "authors": "Matusik R.J., Newcomer M.E., Lareyre J.-J., Orgebin-Crist M.-C., Kasper S., Ong D.E., Zhao G.-Q., Zheng W.-L.", "date": "1998" } ], "uniprot_ac": "A2AJB7", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7#A2AJB7-4", "isoform_ac": "A2AJB7-4", "locus": {}, "sequence": { "header": "sp|A2AJB7-4|LCN5_MOUSE Isoform 4 of Epididymal-specific lipocalin-5 OS=Mus musculus OX=10090 GN=Lcn5 PE=1 SV=1 CANONICAL=A2AJB7-1", "length": 164, "sequence": "MAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI" } }, { "url": "https://www.uniprot.org/uniprot/A2AJB7#A2AJB7-2", "isoform_ac": "A2AJB7-2", "locus": { "end_pos": 25657981, "strand": "-", "start_pos": 25661446, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000100312", "id": "ENSMUST00000100312", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000097887", "id": "ENSMUSP00000097887", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AJB7-2|LCN5_MOUSE Isoform 2 of Epididymal-specific lipocalin-5 OS=Mus musculus OX=10090 GN=Lcn5 PE=1 SV=1 CANONICAL=A2AJB7-1", "length": 192, "sequence": "MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDYIEIKALPKPGS" } }, { "url": "https://www.uniprot.org/uniprot/A2AJB7#A2AJB7-3", "isoform_ac": "A2AJB7-3", "locus": { "end_pos": 25657981, "strand": "-", "start_pos": 25660996, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000100313", "id": "ENSMUST00000100313", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000097888", "id": "ENSMUSP00000097888", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AJB7-3|LCN5_MOUSE Isoform 3 of Epididymal-specific lipocalin-5 OS=Mus musculus OX=10090 GN=Lcn5 PE=1 SV=1 CANONICAL=A2AJB7-1", "length": 180, "sequence": "MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHD" } }, { "url": "https://www.uniprot.org/uniprot/A2AJB7#A2AJB7-1", "isoform_ac": "A2AJB7-1", "locus": { "end_pos": 25657981, "strand": "-", "start_pos": 25661551, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000028306", "id": "ENSMUST00000028306", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000028306", "id": "ENSMUSP00000028306", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AJB7-1|LCN5_MOUSE Isoform 1 of Epididymal-specific lipocalin-5 OS=Mus musculus OX=10090 GN=Lcn5 PE=1 SV=1 CANONICAL=A2AJB7-1", "length": 192, "sequence": "MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13863", "resource": "KEGG Pathway", "id": "mmu:13863", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "annotation": "Forkhead box A2 restricts androgen-regulated gene expression of lipocalin 5 in the mouse epididymis.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A2AJB7#function", "annotation": "Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7#function", "id": "A2AJB7", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "P06911-1", "protein_name": "Epididymal-specific lipocalin-5", "sequence": { "length": 188, "sequence": "MENIMPFALLGLCVGLAAGTEGAVVKDFDISKFLGFWYEIAFASKMGTPGLAHKEEKMGAMVVELKENLLALTTTYYSEDHCVLEKVTATEGDGPAKFQVTRLSGKKEVVVEATDYLTYAIIDITSLVAGAVHRTMKLYSRSLDDNGEALYNFRKITSDHGFSETDLYILKHDLTCVKVLQSAAESRP" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AJB7/", "id": "A2AJB7", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/7305", "id": "7305", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "ac": "NP_001036095.1", "name": "epididymal-specific lipocalin-5 isoform b precursor", "summary": "This gene encodes a small secreted protein that is expressed in the epididymis and binds retinoic acid. The precursor protein is processed into both a longer major form and a shorter minor form. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005501", "pmid": "11058762", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "name": "retinoid binding", "id": "GO:0005501" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036094", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "name": "small molecule binding", "id": "GO:0036094" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "pmid": "11058762", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "name": "extracellular space", "id": "GO:0005615" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042573", "pmid": "10936050", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "id": "A2AJB7", "database": "UniProtKB" } ], "name": "retinoic acid metabolic process", "id": "GO:0042573" } ], "total": 1, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJB7", "type": "synonym", "resource": "RefSeq", "name": "Lcn5" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJB7", "type": "synonym", "resource": "RefSeq", "name": "E-RABP; Erabp; MEP10" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "synonym", "resource": "UniProtKB", "name": "Mep10" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "recommended", "resource": "UniProtKB", "name": "Lcn5" } ], "crossref": [ { "url": "http://pfam.xfam.org/family/PF00061", "id": "PF00061", "database": "Pfam" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13863", "id": "mmu:13863", "database": "KEGG Pathway" }, { "url": "http://www.orthodb.org/?query=1291941at2759", "id": "1291941at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11430", "id": "PTHR11430", "database": "PANTHER" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR022272", "id": "IPR022272", "database": "InterPro" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000026937", "id": "ENSMUSG00000026937", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/13863", "id": "13863", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000566", "id": "IPR000566", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR012674", "id": "IPR012674", "database": "InterPro" }, { "url": "http://www.informatics.jax.org/marker/MGI:1277241", "id": "1277241", "database": "MGI" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR002345", "id": "IPR002345", "database": "InterPro" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2AJB7", "id": "PR_A2AJB7", "database": "PRO" }, { "url": "https://omabrowser.org/oma/group/MENIMPF/", "id": "MENIMPF", "database": "OMA" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036095.1", "id": "NP_001036095.1", "database": "RefSeq" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 21013.0, "chemical_mass": 21013.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "name": "Lcn5", "locus": { "end_pos": 25661977, "strand": "+", "start_pos": 25657952, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000026937", "id": "ENSMUSG00000026937", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "synonym", "resource": "UniProtKB", "name": "MEP 10" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "synonym", "resource": "UniProtKB", "name": "Epididymal secretory protein 10" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "recommended", "resource": "UniProtKB", "name": "Epididymal-specific lipocalin-5" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJB7", "type": "synonym", "resource": "RefSeq", "name": "epididymal-specific lipocalin-5 isoform b precursor" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "synonym", "resource": "UniProtKB", "name": "E-RABP" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "synonym", "resource": "UniProtKB", "name": "mE-RABP" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJB7", "type": "synonym", "resource": "RefSeq", "name": "epididymal-specific lipocalin-5; lcn5; epididymal retinoic acid binding protein; epididymal secretory protein 10" }, { "url": "https://www.uniprot.org/uniprot/A2AJB7", "type": "synonym", "resource": "UniProtKB", "name": "Epididymal retinoic acid-binding protein" } ] }