{ "uniprot_canonical_ac": "A1KXC4-1", "ptm_annotation": [], "sequence": { "header": "sp|A1KXC4-1|FAIM3_MOUSE Isoform 1 of Fas apoptotic inhibitory molecule 3 OS=Mus musculus OX=10090 GN=Fcmr PE=2 SV=2 CANONICAL=A1KXC4-1", "length": 422, "sequence": "MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRLAMRRRGRGASRPFPTQRRDASQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASPASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDDYINIPDPSHLPSYAPGPRSSCP" }, "uniprot_id": "FAIM3_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21613257", "type": [ "PubMed" ], "id": "21613257" } ], "title": "Toso regulates the balance between apoptotic and nonapoptotic death receptor signaling by facilitating RIP1 ubiquitination.", "journal": "Blood", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Nguyen XH, Lang PA, Lang KS, Adam D, Fattakhova G, Foger N, Kamal MA, Prilla P, Mathieu S, Wagner C, Mak T, Chan AC, Lee KH", "date": "2011" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25257173", "type": [ "PubMed" ], "id": "25257173" } ], "title": "Toso regulates differentiation and activation of inflammatory dendritic cells during persistence-prone virus infection.", "journal": "Cell death and differentiation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Lang PA, Meryk A, Pandyra AA, Brenner D, Brustle A, Xu HC, Merches K, Lang F, Khairnar V, Sharma P, Funkner P, Recher M, Shaabani N, Duncan GS, Duhan V, Homey B, Ohashi PS, Haussinger D, Knolle PA, Honke N, Mak TW, Lang KS", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22988094", "type": [ "PubMed" ], "id": "22988094" } ], "title": "Critical role of the IgM Fc receptor in IgM homeostasis, B-cell survival, and humoral immune responses.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Ouchida R, Mori H, Hase K, Takatsu H, Kurosaki T, Tokuhisa T, Ohno H, Wang JY", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27626380", "type": [ "PubMed" ], "id": "27626380" } ], "title": "High-throughput discovery of novel developmental phenotypes.", "journal": "Nature", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bucan M, Murray SA", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22984178", "type": [ "PubMed" ], "id": "22984178" } ], "title": "Altered Ig levels and antibody responses in mice deficient for the Fc receptor for IgM (FcmuR).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Honjo K, Kubagawa Y, Jones DM, Dizon B, Zhu Z, Ohno H, Izui S, Kearney JF, Kubagawa H", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20042454", "type": [ "PubMed" ], "id": "20042454" } ], "title": "Identification of TOSO/FAIM3 as an Fc receptor for IgM.", "journal": "International immunology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Shima H, Takatsu H, Fukuda S, Ohmae M, Hase K, Kubagawa H, Wang JY, Ohno H", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/29461978", "type": [ "PubMed" ], "id": "29461978" } ], "title": "Surface receptor Toso controls B cell-mediated regulation of T cell immunity.", "journal": "The Journal of clinical investigation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Yu J, Duong VHH, Westphal K, Westphal A, Suwandi A, Grassl GA, Brand K, Chan AC, Foger N, Lee KH", "date": "2018" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/15632112", "type": [ "PubMed" ], "id": "15632112" } ], "title": "The mouse cell surface protein TOSO regulates Fas/Fas ligand-induced apoptosis through its binding to Fas-associated death domain.", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Song Y, Jacob CO", "date": "2005" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/31213601", "type": [ "PubMed" ], "id": "31213601" } ], "title": "Fcmr regulates mononuclear phagocyte control of anti-tumor immunity.", "journal": "Nature communications", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ], "authors": "Kubli SP, Vornholz L, Duncan G, Zhou W, Ramachandran P, Fortin J, Cox M, Han S, Nechanitzky R, Nechanitzky D, Snow BE, Jones L, Li WY, Haight J, Wakeham A, Bray MR, Mak TW", "date": "2019" } ], "uniprot_ac": "A1KXC4", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4#A0A0G2LB91-1", "isoform_ac": "A0A0G2LB91-1", "locus": { "end_pos": 130865860, "start_pos": 130880648, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000038829", "id": "ENSMUST00000038829", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000048303", "id": "ENSMUSP00000048303", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2LB91-1|FAIM3_MOUSE Computationally mapped isoform of Fas apoptotic inhibitory molecule 3 OS=Mus musculus OX=10090 GN=Fcmr PE=2 SV=1 CANONICAL=A1KXC4-1", "length": 422, "sequence": "MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPTPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRLAMRRRGRGASRPFPTQRRDASQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASPASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDDYINIPDPSHLPSYAPGPRSSCQ" } }, { "url": "https://www.uniprot.org/uniprot/A1KXC4#A1KXC4-1", "isoform_ac": "A1KXC4-1", "locus": {}, "sequence": { "header": "sp|A1KXC4-1|FAIM3_MOUSE Isoform 1 of Fas apoptotic inhibitory molecule 3 OS=Mus musculus OX=10090 GN=Fcmr PE=2 SV=2 CANONICAL=A1KXC4-1", "length": 422, "sequence": "MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRLAMRRRGRGASRPFPTQRRDASQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASPASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDDYINIPDPSHLPSYAPGPRSSCP" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69169", "resource": "KEGG Pathway", "id": "mmu:69169", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "annotation": "During influenza A-induced pulmonary inflammation, the application of Toso-specific antibodies selectively induced IL-10-competent B cells at the site of inflammation and resulted in decreased proinflammatory cytokine production by lung T cells.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "annotation": "Study demonstrated that Fcmr (Toso), the putative receptor for soluble IgM, modulates myeloid cell responses to cancer. In a syngeneic melanoma model, Fcmr ablation in myeloid cells suppressed tumor growth and extended mouse survival. Fcmr deficiency increased myeloid cell population density in this malignancy and enhanced anti-tumor immunity. Erratum:[Nat Commun. 2019 Sep 3;10(1):4069. PMID: 31481706] Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "annotation": "MTOSO overexpressing primary T lymphocytes are resistant to Fas/Fas ligand-induced apoptosis.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A1KXC4#function", "annotation": "May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4#function", "id": "A1KXC4", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "annotation": "These results identify TOSO/FAIM3 as a receptor for IgM", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "annotation": "Toso has an essential role in the differentiation and maturation of iDCs, a process that is required for the control of persistence-prone virus infection.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q5M871-1", "protein_name": "Fas apoptotic inhibitory molecule 3", "sequence": { "length": 426, "sequence": "MNLWLWLLYFLPVSGTLKVLPEVRLEVELGGSVFIECPLPQTHVRMYLCRQMTNPAICATVVSNIFVKKEYKRRVTLKPSLNKKLFLVEMTQLTKDDEGIYACGVGTNTDLGKTQKVTLNVRNEFPEYPEPFWDDEPTSEPSPRWWLHRYPEELPWLKMGEHASPSGFIDKVTTLSPKTEAPPVHQPSTNTSVSRHPRVYGASSETPTKPSALLPATTAFKTSARQASRLLEASYSHHTRLHGERTPHYGSQYGREDRGLHISIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRAFSRRVGRMARRMRGRGPSRQIPTQRRDAPQRPRSQNNVYSACPRRAREPDNVGSAEALLLNAPASAPPALPLVIETSWPHTPSLKMSCEYVSLGHQPAVNVEDQDSNDYINIPGLPHLPSKPPGPRPSRQ" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48347", "id": "48347", "database": "MGI" } ], "common_name": "rats", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "O60667-1", "protein_name": "Fas apoptotic inhibitory molecule 3", "sequence": { "length": 390, "sequence": "MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQGFHILIPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALESSQRPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVSESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48347", "id": "48347", "database": "MGI" } ], "common_name": "man", "organism": "Homo sapiens", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "ac": "NP_081252.1", "name": "fas apoptotic inhibitory molecule 3 precursor", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "pmid": "15632112", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "cell surface", "id": "GO:0009986" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "pmid": "15632112", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "external side of plasma membrane", "id": "GO:0009897" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070229", "pmid": "15632112", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "negative regulation of lymphocyte apoptotic process", "id": "GO:0070229" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "pmid": "15632112", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990001", "pmid": "15632112", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "inhibition of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:1990001" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "name": "immune system process", "id": "GO:0002376" } ], "total": 4, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1KXC4", "type": "synonym", "resource": "RefSeq", "name": "Fcmr" }, { "url": "https://www.uniprot.org/uniprot/A1KXC4", "type": "recommended", "resource": "UniProtKB", "name": "Fcmr" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1KXC4", "type": "synonym", "resource": "RefSeq", "name": "1810037B05Rik; Faim3; FcmuR; Toso" }, { "url": "https://www.uniprot.org/uniprot/A1KXC4", "type": "synonym", "resource": "UniProtKB", "name": "Toso" }, { "url": "https://www.uniprot.org/uniprot/A1KXC4", "type": "synonym", "resource": "UniProtKB", "name": "Faim3" } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/gene/69169", "id": "69169", "database": "GeneID" }, { "url": "http://www.informatics.jax.org/marker/MGI:1916419", "id": "1916419", "database": "MGI" }, { "url": "http://www.orthodb.org/?query=1378301at2759", "id": "1378301at2759", "database": "OrthoDB" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "id": "IPR013783", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "id": "IPR013106", "database": "InterPro" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1KXC4", "id": "PR_A1KXC4", "database": "PRO" }, { "url": "http://pfam.xfam.org/family/PF07686", "id": "PF07686", "database": "Pfam" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081252.1", "id": "NP_081252.1", "database": "RefSeq" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69169", "id": "mmu:69169", "database": "KEGG Pathway" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "id": "IPR036179", "database": "InterPro" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Thr", "position": "91", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "id": "A1KXC4", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" } ], "mass": { "monoisotopic_mass": 47471.0, "chemical_mass": 47471.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "name": "Fcmr", "locus": { "end_pos": 130880791, "start_pos": 130865669, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000042474", "id": "ENSMUSG00000042474", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1KXC4", "type": "synonym", "resource": "UniProtKB", "name": "IgM Fc fragment receptor" }, { "url": "https://www.uniprot.org/uniprot/A1KXC4", "type": "recommended", "resource": "UniProtKB", "name": "Fas apoptotic inhibitory molecule 3" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1KXC4", "type": "synonym", "resource": "RefSeq", "name": "regulator of Fas-induced apoptosis Toso; Fas apoptotic inhibitory molecule 3; IgM Fc fragment receptor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1KXC4", "type": "synonym", "resource": "RefSeq", "name": "fas apoptotic inhibitory molecule 3 precursor" }, { "url": "https://www.uniprot.org/uniprot/A1KXC4", "type": "synonym", "resource": "UniProtKB", "name": "Regulator of Fas-induced apoptosis Toso" } ] }