{ "uniprot_canonical_ac": "A1A5R2-1", "ptm_annotation": [], "sequence": { "header": "tr|A1A5R2-1|A1A5R2_RAT Isoform 1 of G protein-coupled receptor, family C, group 5, member A OS=Rattus norvegicus OX=10116 GN=Gprc5a PE=1 SV=1 CANONICAL=A1A5R2-1", "length": 358, "sequence": "MTTPRAAAPSGCRSDLDSRYYRLCDLAEGWGIALETLAAVGAVATVALMFALVFLICKVQDSSKRKMLPTQFLFLLGVLGVFGLTFAFIIKLDRATGPTRFFLFGVLFALCFSCLLAHAFNLIKLVRGRKPLSWLVILSLAVGFSLVQDVIAIEFLVLTMNRTNVNVFSQLPAPRRNEDFVMLLIYVLFLMVLTFVASLLVFCGSFSGWKRHGIHICLTSFLSIAIWVAWIILLLIPDIDRKWDDTILSTVLVANGWVFLVFYILPEFRQLPRQRSSTDYPVEDAFCKPQLMKQSYGVENRAYSQEEITQGLEEMGDTLYAPYSTHFQMQNRQKDFSIPRAHTPASPYNDYEGRKGDS" }, "uniprot_id": "A1A5R2_RAT", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "rats", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22673903", "type": [ "PubMed" ], "id": "22673903" } ], "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "authors": "Olsen J.V., Lage K., Secher A., Dmytriyev A., Lundby A., Lundby C., Nordsborg N.B.", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25744720", "type": [ "PubMed" ], "id": "25744720" } ], "title": "Lung Tumor Suppressor GPRC5A Binds EGFR and Restrains Its Effector Signaling.", "journal": "Cancer research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073359.1", "id": "NP_001073359.1", "database": "RefSeq" } ], "authors": "Zhong S, Yin H, Liao Y, Yao F, Li Q, Zhang J, Jiao H, Zhao Y, Xu D, Liu S, Song H, Gao Y, Liu J, Ma L, Pang Z, Yang R, Ding C, Sun B, Lin X, Ye X, Guo W, Han B, Zhou BP, Chin YE, Deng J", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25468996", "type": [ "PubMed" ], "id": "25468996" } ], "title": "E-cadherin interactome complexity and robustness resolved by quantitative proteomics.", "journal": "Science signaling", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073359.1", "id": "NP_001073359.1", "database": "RefSeq" } ], "authors": "Guo Z, Neilson LJ, Zhong H, Murray PS, Zanivan S, Zaidel-Bar R", "date": "2014" } ], "uniprot_ac": "A1A5R2", "site_annotation": [ { "end_pos": 163, "annotation": "n_glycosylation_sequon", "start_pos": 161 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2#A1A5R2-1", "isoform_ac": "A1A5R2-1", "locus": { "end_pos": 168845340, "start_pos": 168850777, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000011134", "id": "ENSRNOT00000011134", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000011134", "id": "ENSRNOP00000011134", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A1A5R2-1|A1A5R2_RAT Isoform 1 of G protein-coupled receptor, family C, group 5, member A OS=Rattus norvegicus OX=10116 GN=Gprc5a PE=1 SV=1 CANONICAL=A1A5R2-1", "length": 358, "sequence": "MTTPRAAAPSGCRSDLDSRYYRLCDLAEGWGIALETLAAVGAVATVALMFALVFLICKVQDSSKRKMLPTQFLFLLGVLGVFGLTFAFIIKLDRATGPTRFFLFGVLFALCFSCLLAHAFNLIKLVRGRKPLSWLVILSLAVGFSLVQDVIAIEFLVLTMNRTNVNVFSQLPAPRRNEDFVMLLIYVLFLMVLTFVASLLVFCGSFSGWKRHGIHICLTSFLSIAIWVAWIILLLIPDIDRKWDDTILSTVLVANGWVFLVFYILPEFRQLPRQRSSTDYPVEDAFCKPQLMKQSYGVENRAYSQEEITQGLEEMGDTLYAPYSTHFQMQNRQKDFSIPRAHTPASPYNDYEGRKGDS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:312790", "resource": "KEGG Pathway", "id": "rno:312790", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "sequence": { "length": 357, "sequence": "MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/2961", "id": "2961", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A1A5R2/", "id": "A1A5R2", "database": "OMA" } ], "common_name": "man", "organism": "Homo sapiens", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073359.1", "ac": "NP_001073359.1", "name": "retinoic acid-induced protein 3", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030295", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "protein kinase activator activity", "id": "GO:0030295" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "G protein-coupled receptor activity", "id": "GO:0004930" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "intracellular membrane-bounded organelle", "id": "GO:0043231" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "receptor complex", "id": "GO:0043235" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "extracellular exosome", "id": "GO:0070062" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "nucleolus", "id": "GO:0005730" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "id": "A1A5R2", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" } ], "total": 6, "name": "Cellular Component" } ] }, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "type": "synonym", "resource": "UniProtKB", "name": "rCG_29595" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A5R2", "type": "synonym", "resource": "RefSeq", "name": "Rai3" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A5R2", "type": "synonym", "resource": "RefSeq", "name": "Gprc5a" }, { "url": "https://www.uniprot.org/uniprot/A1A5R2", "type": "recommended", "resource": "UniProtKB", "name": "Gprc5a" } ], "crossref": [ { "url": "https://omabrowser.org/oma/group/NDYEGRK/", "id": "NDYEGRK", "database": "OMA" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/312790", "id": "312790", "database": "GeneID" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000008412", "id": "ENSRNOG00000008412", "database": "Bgee" }, { "url": "http://www.orthodb.org/?query=807909at2759", "id": "807909at2759", "database": "OrthoDB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073359.1", "id": "NP_001073359.1", "database": "RefSeq" }, { "url": "http://pfam.xfam.org/family/PF00003", "id": "PF00003", "database": "Pfam" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:312790", "id": "rno:312790", "database": "KEGG Pathway" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310804", "id": "1310804", "database": "RGD" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR017978", "id": "IPR017978", "database": "InterPro" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 40452.0, "chemical_mass": 40452.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1A5R2", "name": "Gprc5a", "locus": { "end_pos": 168851652, "start_pos": 168832910, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000008412", "id": "ENSRNOG00000008412", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A5R2", "type": "synonym", "resource": "RefSeq", "name": "retinoic acid induced 3; G protein-coupled receptor, family C, group 5, member A" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A5R2", "type": "synonym", "resource": "RefSeq", "name": "retinoic acid-induced protein 3" }, { "url": "https://www.uniprot.org/uniprot/A1A5R2", "type": "synonym", "resource": "UniProtKB", "name": "G protein-coupled receptor, class C, group 5, member A" }, { "url": "https://www.uniprot.org/uniprot/A1A5R2", "type": "synonym", "resource": "UniProtKB", "name": "G protein-coupled receptor, family C, group 5, member A" } ] }