{ "uniprot_canonical_ac": "A1A4G5-1", "ptm_annotation": [], "sequence": { "header": "sp|A1A4G5-1|LNP1_HUMAN Isoform 1 of Leukemia NUP98 fusion partner 1 OS=Homo sapiens OX=9606 GN=LNP1 PE=2 SV=1 CANONICAL=A1A4G5-1", "length": 178, "sequence": "MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSDCHPRRHSHEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE" }, "uniprot_id": "LNP1_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "man", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A4G5", "id": "A1A4G5", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16467868", "type": [ "PubMed" ], "id": "16467868" } ], "title": "NUP98 rearrangements in hematopoietic malignancies: a study of the Groupe Francophone de Cytogenetique Hematologique.", "journal": "Leukemia", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A4G5", "id": "A1A4G5", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078920.1", "id": "NP_001078920.1", "database": "RefSeq" } ], "authors": "Berger R., Rack K., Bernard O.A., Vekemans M., Tigaud I., Charrin C., Dastugue N., Petit A., Radford-Weiss I., Schluth C., Bilhou-Nabera C., Cabrol C., Talmant P., Romana S.P., Poirel H., Cornillet-Lefebvre P., Lafage-Pochitaloff M., Mozziconacci M.-J., Perot C., Andrieu J., Ben Abdelali R., Fert-Ferrer S., Lai J.-L., Luquet I., Mugneret F., Nadal N., Nguyen-Khac F., Terre C., Van den Akker J.", "date": "2006" } ], "uniprot_ac": "A1A4G5", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1A4G5#A1A4G5-1", "isoform_ac": "A1A4G5-1", "locus": { "end_pos": 100429730, "start_pos": 100455923, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000383693", "id": "ENST00000383693", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000373191", "id": "ENSP00000373191", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1A4G5-1|LNP1_HUMAN Isoform 1 of Leukemia NUP98 fusion partner 1 OS=Homo sapiens OX=9606 GN=LNP1 PE=2 SV=1 CANONICAL=A1A4G5-1", "length": 178, "sequence": "MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSDCHPRRHSHEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE" } }, { "url": "https://www.uniprot.org/uniprot/A1A4G5#C9J587-1", "isoform_ac": "C9J587-1", "locus": { "end_pos": 100429730, "start_pos": 100455923, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000489752", "id": "ENST00000489752", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000417985", "id": "ENSP00000417985", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|C9J587-1|LNP1_HUMAN Computationally mapped isoform of Leukemia NUP98 fusion partner 1 OS=Homo sapiens OX=9606 GN=LNP1 PE=2 SV=1 CANONICAL=A1A4G5-1", "length": 191, "sequence": "MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPSFYTVNFFILYSQLPVLPRIPSSDCHPRRHSHEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE" } }, { "url": "https://www.uniprot.org/uniprot/A1A4G5#F8WF60-1", "isoform_ac": "F8WF60-1", "locus": { "end_pos": 100429730, "start_pos": 100451747, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000466996", "id": "ENST00000466996", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000419213", "id": "ENSP00000419213", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|F8WF60-1|LNP1_HUMAN Computationally mapped isoform of Leukemia NUP98 fusion partner 1 OS=Homo sapiens OX=9606 GN=LNP1 PE=2 SV=1 CANONICAL=A1A4G5-1", "length": 56, "sequence": "MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPNSII" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:348801", "resource": "KEGG Pathway", "id": "hsa:348801", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "A0A1B0GSK3-1", "protein_name": "Leukemia NUP98 fusion partner 1", "sequence": { "length": 178, "sequence": "MEHRDDDDDNDDVSFAKWMSSFWGHSWRDKDERGLRDHQQLQEASYRKASLPCPFPAFPSITSSDCHPRRHSHEDQGSRSHLPTRHHRKCSVDGSLREPTESQRRAHSKMQEFSESFERHLCLQTKPSHSVGPKGKKERDERHCLETTMRSYKRVEDRRSSVKDGDGPMDPLIERGPE" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/67109", "id": "67109", "database": "MGI" } ], "common_name": "mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "T", "start_pos": 47, "alt_nt": "C", "chr_id": "3", "ref_nt": "A", "chr_pos": "100148712", "disease": [ { "synonyms": [], "recommended_name": { "id": "1324", "url": "http://disease-ontology.org/term/DOID:1324", "resource": "Disease Ontology", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1A4G5", "id": "A1A4G5", "database": "BioMuta" } ], "frequency": "1.5", "sequence_mut": "P", "subjects_tested": "66", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.5%).", "end_pos": 47, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078920.1", "ac": "NP_001078920.1", "name": "leukemia NUP98 fusion partner 1", "summary": "" }, "go_annotation": {}, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A1A4G5", "type": "recommended", "resource": "UniProtKB", "name": "LNP1" }, { "url": "https://www.uniprot.org/uniprot/A1A4G5", "type": "synonym", "resource": "UniProtKB", "name": "NP3" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A4G5", "type": "synonym", "resource": "RefSeq", "name": "LNP1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A4G5", "type": "synonym", "resource": "RefSeq", "name": "NP3" } ], "crossref": [ { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1A4G5", "id": "PR_A1A4G5", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/348801", "id": "348801", "database": "GeneID" }, { "url": "https://pharos.nih.gov/targets/A1A4G5", "id": "A1A4G5", "database": "PHAROS" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1A4G5", "id": "A1A4G5", "database": "BioMuta" }, { "url": "https://www.nextprot.org/entry/NX_A1A4G5", "id": "NX_A1A4G5", "database": "neXtProt" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:348801", "id": "hsa:348801", "database": "KEGG Pathway" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078920.1", "id": "NP_001078920.1", "database": "RefSeq" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1A4G5*", "id": "A1A4G5", "database": "IntAct" }, { "url": "http://www.orthodb.org/?query=1320740at2759", "id": "1320740at2759", "database": "OrthoDB" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LNP1", "id": "LNP1", "database": "GeneCards" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029280", "id": "IPR029280", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF15419", "id": "PF15419", "database": "Pfam" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35667", "id": "PTHR35667", "database": "PANTHER" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=28014", "id": "28014", "database": "HGNC" } ], "expression_disease": [ { "name": "Liver cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "Yes" }, { "name": "Prostate cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4G5", "id": "A1A4G5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 21321.0, "chemical_mass": 21321.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000206535", "id": "ENSG00000206535", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1A4G5", "name": "LNP1", "locus": { "end_pos": 100456319, "start_pos": 100401193, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000206535", "id": "ENSG00000206535", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1A4G5", "type": "recommended", "resource": "UniProtKB", "name": "Leukemia NUP98 fusion partner 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A4G5", "type": "synonym", "resource": "RefSeq", "name": "leukemia NUP98 fusion partner 1" } ] }