{
    "uniprot_canonical_ac": "A2RT62-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "sp|A2RT62-1|FXL16_MOUSE Isoform 1 of F-box/LRR-repeat protein 16  OS=Mus musculus OX=10090 GN=Fbxl16 PE=1 SV=1 CANONICAL=A2RT62-1", 
        "length": 479, 
        "sequence": "MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPAAKNRPCQPPPPPTLPPPSLATPLSRVALAGGPCPPASGPASGPVSGPPVERPPLATDEKILNGLFWYFSACEKCILAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYSLSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAMRNLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE"
    }, 
    "uniprot_id": "FXL16_MOUSE", 
    "enzyme_annotation": [], 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2RT62", 
                    "id": "A2RT62", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/24390425", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "24390425"
                }
            ], 
            "title": "F-box protein FBXL16 binds PP2A-B55alpha and regulates differentiation of embryonic stem cells along the FLK1+ lineage.", 
            "journal": "Molecular & cellular proteomics : MCP", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
                    "id": "NP_001157697.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Honarpour N, Rose CM, Brumbaugh J, Anderson J, Graham RL, Sweredoski MJ, Hess S, Coon JJ, Deshaies RJ", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/24194600", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "24194600"
                }
            ], 
            "title": "The International Mouse Phenotyping Consortium Web Portal, a unified point of access for knockout mice and related phenotyping data.", 
            "journal": "Nucleic acids research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
                    "id": "NP_001157697.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Koscielny G, Yaikhom G, Iyer V, Meehan TF, Morgan H, Atienza-Herrero J, Blake A, Chen CK, Easty R, Di Fenza A, Fiegel T, Grifiths M, Horne A, Karp NA, Kurbatova N, Mason JC, Matthews P, Oakley DJ, Qazi A, Regnart J, Retha A, Santos LA, Sneddon DJ, Warren J, Westerberg H, Wilson RJ, Melvin DG, Smedley D, Brown SD, Flicek P, Skarnes WC, Mallon AM, Parkinson H", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/24129315", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "24129315"
                }
            ], 
            "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", 
            "journal": "Mol. Cell. Proteomics", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2RT62", 
                    "id": "A2RT62", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Beausoleil S.A., Wang Y., Zhou J., Comb M.J., Guo A., Lee K.A., Aguiar M., Bedford M.T., Gu H., Jia X., Kornhauser J., Mulhern D., Ren J., Silva J.C., Vemulapalli V., Yang V.", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/17603280", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "17603280"
                }
            ], 
            "title": "Identification and characterization of scirr1, a novel gene up-regulated after spinal cord injury.", 
            "journal": "Experimental & molecular medicine", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
                    "id": "NP_001157697.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Liu T, Ma Z, Que H, Li X, Ni Y, Jing S, Liu S", 
            "date": "2007"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/27626380", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "27626380"
                }
            ], 
            "title": "High-throughput discovery of novel developmental phenotypes.", 
            "journal": "Nature", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
                    "id": "NP_001157697.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bucan M, Murray SA", 
            "date": "2016"
        }
    ], 
    "uniprot_ac": "A2RT62", 
    "site_annotation": [
        {
            "end_pos": 323, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 321
        }, 
        {
            "end_pos": 189, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 187
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62#A2RT62-1", 
            "isoform_ac": "A2RT62-1", 
            "locus": {
                "end_pos": 25816431, 
                "start_pos": 25819519, 
                "chromosome": "17", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000045692", 
                        "id": "ENSMUST00000045692", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000048562", 
                        "id": "ENSMUSP00000048562", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A2RT62-1|FXL16_MOUSE Isoform 1 of F-box/LRR-repeat protein 16  OS=Mus musculus OX=10090 GN=Fbxl16 PE=1 SV=1 CANONICAL=A2RT62-1", 
                "length": 479, 
                "sequence": "MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPAAKNRPCQPPPPPTLPPPSLATPLSRVALAGGPCPPASGPASGPVSGPPVERPPLATDEKILNGLFWYFSACEKCILAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYSLSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAMRNLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62#A0A494B9I8-1", 
            "isoform_ac": "A0A494B9I8-1", 
            "locus": {
                "end_pos": 25818059, 
                "start_pos": 25819520, 
                "chromosome": "17", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000235694", 
                        "id": "ENSMUST00000235694", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000157669", 
                        "id": "ENSMUSP00000157669", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A0A494B9I8-1|FXL16_MOUSE Computationally mapped isoform of F-box/LRR-repeat protein 16  OS=Mus musculus OX=10090 GN=Fbxl16 PE=1 SV=1 CANONICAL=A2RT62-1", 
                "length": 122, 
                "sequence": "XELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDSLYLRWCCQVQDFGLKHLLAMRNLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8951664", 
            "resource": "Reactome", 
            "id": "R-MMU-8951664", 
            "name": "Neddylation"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983168", 
            "resource": "Reactome", 
            "id": "R-MMU-983168", 
            "name": "Antigen processing: Ubiquitination & Proteasome degradation"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:214931", 
            "resource": "KEGG Pathway", 
            "id": "mmu:214931", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
            "annotation": "SCIRR1 ise involved in the succeeding injury and/or repair processes of the injured spinal cord.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
                    "id": "NP_001157697.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62#function", 
            "annotation": "Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2RT62#function", 
                    "id": "A2RT62", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
            "annotation": "FBXL16 negatively regulates the activity of B55alpha-PP2A to modulate the genesis of FLK1+ progenitor cells.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
                    "id": "NP_001157697.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q5MJ12-1", 
            "protein_name": "F-box/LRR-repeat protein 16", 
            "sequence": {
                "length": 479, 
                "sequence": "MSSPGIDGDPKPSCLPRNGLVKLPGQPNGLGAASITKGTPAAKNRPCQPPPPPTLPPPSLATPLSRVALAGGPCPPASGPASGPVPGPPVERPPLATDEKILNGLFWYFSACEKCILAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYSLSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAMRSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/17732", 
                    "id": "17732", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A2RT62/", 
                    "id": "A2RT62", 
                    "database": "OMA"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q8N461-1", 
            "protein_name": "F-box/LRR-repeat protein 16", 
            "sequence": {
                "length": 479, 
                "sequence": "MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/17732", 
                    "id": "17732", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A2RT62/", 
                    "id": "A2RT62", 
                    "database": "OMA"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
        "ac": "NP_001157697.1", 
        "name": "F-box/LRR-repeat protein 16", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019005", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT62", 
                                "id": "A2RT62", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "SCF ubiquitin ligase complex", 
                        "id": "GO:0019005"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT62", 
                                "id": "A2RT62", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cytoplasm", 
                        "id": "GO:0005737"
                    }
                ], 
                "total": 2, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT62", 
                                "id": "A2RT62", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "ubiquitin-dependent protein catabolic process", 
                        "id": "GO:0006511"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031146", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT62", 
                                "id": "A2RT62", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process", 
                        "id": "GO:0031146"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT62", 
                                "id": "A2RT62", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein ubiquitination", 
                        "id": "GO:0016567"
                    }
                ], 
                "total": 3, 
                "name": "Biological Process"
            }
        ]
    }, 
    "gene_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Fbxl16"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT62", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Fbxl16"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT62", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "BC042620; Scirr1"
        }
    ], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000025738", 
            "id": "ENSMUSG00000025738", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/RGFQSFC/", 
            "id": "RGFQSFC", 
            "database": "OMA"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF13516", 
            "id": "PF13516", 
            "database": "Pfam"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", 
            "id": "IPR032675", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157697.1", 
            "id": "NP_001157697.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:214931", 
            "id": "mmu:214931", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8951664", 
            "id": "R-MMU-8951664", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006553", 
            "id": "IPR006553", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036047", 
            "id": "IPR036047", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/214931", 
            "id": "214931", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001611", 
            "id": "IPR001611", 
            "database": "InterPro"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2RT62", 
            "id": "PR_A2RT62", 
            "database": "PRO"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2448488", 
            "id": "2448488", 
            "database": "MGI"
        }, 
        {
            "url": "http://www.orthodb.org/?query=1282076at2759", 
            "id": "1282076at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983168", 
            "id": "R-MMU-983168", 
            "database": "Reactome"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 51878.0, 
        "chemical_mass": 51878.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62", 
            "name": "Fbxl16", 
            "locus": {
                "end_pos": 25821244, 
                "start_pos": 25809085, 
                "chromosome": "17", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000025738", 
                        "id": "ENSMUSG00000025738", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "F-box/LRR-repeat protein 16"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2RT62", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "F-box and leucine-rich repeat protein 16"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT62", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "F-box/LRR-repeat protein 16"
        }
    ]
}