{
    "uniprot_canonical_ac": "A4KWA1-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "sp|A4KWA1-1|KRBBA_RAT Isoform 1 of Killer cell lectin-like receptor subfamily B member 1B allele A  OS=Rattus norvegicus OX=10116 GN=Klrb1b PE=1 SV=1 CANONICAL=A4KWA1-1", 
        "length": 223, 
        "sequence": "MDTAVVYADLHLARTGEPKREPPPSLSPDTCQCPRWHRLALKLGCACLILLVLSVIGLGVLVLTLLQKPLIQNSPADVQENRTKTTDSPAKLKCPKDWHSHQDKCFHVSQTSITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDEKWKWINGSTLNSDALNITGDTEKDSCASVSQDKVLSESCDSDNIWICQKELKRESTCNDS"
    }, 
    "uniprot_id": "KRBBA_RAT", 
    "enzyme_annotation": [], 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "common_name": "Rat", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4KWA1", 
                    "id": "A4KWA1", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Rattus norvegicus", 
            "taxid": 10116
        }
    ], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/16547249", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "16547249"
                }
            ], 
            "title": "The novel inhibitory NKR-P1C receptor and Ly49s3 identify two complementary, functionally distinct NK cell subsets in rats.", 
            "journal": "J. Immunol.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4KWA1", 
                    "id": "A4KWA1", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Inngjerdingen M., Ryan J.C., Vaage J.T., Baeck C.J., Dai K.-Z., Kveberg L., Naper C., Rolstad B.", 
            "date": "2006"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/17462921", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "17462921"
                }
            ], 
            "title": "Cytomegalovirus evasion of innate immunity by subversion of the NKR-P1B:Ocil/Clr-b missing-self axis.", 
            "journal": "Immunity", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4KWA1", 
                    "id": "A4KWA1", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
                    "id": "NP_775414.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Chen P., Voigt S., Carlyle J.R., Chou W., Mesci A., Ettinger J., Fine J.H.", 
            "date": "2007"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/19130483", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "19130483"
                }
            ], 
            "title": "Two major groups of rat NKR-P1 receptors can be distinguished based on chromosomal localization, phylogenetic analysis and Clr ligand binding.", 
            "journal": "European journal of immunology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
                    "id": "NP_775414.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Kveberg L, Dai KZ, Westgaard IH, Daws MR, Fossum S, Naper C, Vaage JT", 
            "date": "2009"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/2399464", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "2399464"
                }
            ], 
            "title": "NKR-P1, a signal transduction molecule on natural killer cells.", 
            "journal": "Science (New York, N.Y.)", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
                    "id": "NP_775414.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Giorda R, Rudert WA, Vavassori C, Chambers WH, Hiserodt JC, Trucco M", 
            "date": "1990"
        }
    ], 
    "uniprot_ac": "A4KWA1", 
    "site_annotation": [
        {
            "end_pos": 145, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 143
        }, 
        {
            "end_pos": 171, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 169
        }, 
        {
            "end_pos": 181, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 179
        }, 
        {
            "end_pos": 223, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 221
        }, 
        {
            "end_pos": 83, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 81
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1#A0A0G2KAQ0-1", 
            "isoform_ac": "A0A0G2KAQ0-1", 
            "locus": {
                "end_pos": 161950599, 
                "strand": "+", 
                "start_pos": 162025090, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000085887", 
                        "id": "ENSRNOT00000085887", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000075481", 
                        "id": "ENSRNOP00000075481", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A0A0G2KAQ0-1|KRBBA_RAT Computationally mapped isoform of Killer cell lectin-like receptor subfamily B member 1B allele A  OS=Rattus norvegicus OX=10116 GN=Klrb1b PE=1 SV=1 CANONICAL=A4KWA1-1", 
                "length": 223, 
                "sequence": "MDTAVVYADLHLARTGEPKREPPPSLSPDTCQCPRWHRLALKLGCACLILLVLSVIGLGVLVLTLLQKPLIQNSPADVQENRTKTTDSPAKLKCPKDWHSHQDKCFHVSQTSITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDENWKWINGSTLNSDVLSITGDTEKDSCASVSQDKVLSESCDSDNIWVCQKELKCECMCNDS"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1#A4KWA1-1", 
            "isoform_ac": "A4KWA1-1", 
            "locus": {
                "end_pos": 162012656, 
                "strand": "+", 
                "start_pos": 162025090, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000009904", 
                        "id": "ENSRNOT00000009904", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000009904", 
                        "id": "ENSRNOP00000009904", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A4KWA1-1|KRBBA_RAT Isoform 1 of Killer cell lectin-like receptor subfamily B member 1B allele A  OS=Rattus norvegicus OX=10116 GN=Klrb1b PE=1 SV=1 CANONICAL=A4KWA1-1", 
                "length": 223, 
                "sequence": "MDTAVVYADLHLARTGEPKREPPPSLSPDTCQCPRWHRLALKLGCACLILLVLSVIGLGVLVLTLLQKPLIQNSPADVQENRTKTTDSPAKLKCPKDWHSHQDKCFHVSQTSITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDEKWKWINGSTLNSDALNITGDTEKDSCASVSQDKVLSESCDSDNIWICQKELKRESTCNDS"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1#Q5NKN2-1", 
            "isoform_ac": "Q5NKN2-1", 
            "locus": {}, 
            "sequence": {
                "header": "sp|Q5NKN2-1|KRBBA_RAT Computationally mapped isoform of Killer cell lectin-like receptor subfamily B member 1B allele A  OS=Rattus norvegicus OX=10116 GN=Klrb1b PE=1 SV=1 CANONICAL=A4KWA1-1", 
                "length": 223, 
                "sequence": "MDTAVVYADLHLARTGEPKRESPPSLSPDTCQCPRWHRLALKLGCACFILLVLSVIGLGVLVLTLLQKPLLQNSPADVQENRTKSTDSPAKLKCPKDWLSHRDKCFHVSQTSNSWKESLADCDGKGATLLLIQDQEELRFVRNLTKGKDRSFWIGLSYTLPDRNWKWINGSTLNSDVLSITGDTEKGSCASVSQDKVLSESCDSDNIWICQKELKRESTCNDS"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1#Q5NKN4-1", 
            "isoform_ac": "Q5NKN4-1", 
            "locus": {}, 
            "sequence": {
                "header": "sp|Q5NKN4-1|KRBBA_RAT Computationally mapped isoform of Killer cell lectin-like receptor subfamily B member 1B allele A  OS=Rattus norvegicus OX=10116 GN=Klrb1b PE=1 SV=1 CANONICAL=A4KWA1-1", 
                "length": 223, 
                "sequence": "MDTAVVYADLHLARTGEPKHKSPPSLSPDTCQCPRWHRLALKLGCACLILLVLSVIGLGVLVLTLLQKPLIQNSPADVQENRTKTTDSPTKLKCPKDWHSHQDKCFHVSQAPNTWNKSLADCGGKGATLLLIQDQEELRFLRNLTKGKDRSFWIGLNYTLPDKNWKWINSSTLNSDVLSIFGDTKQNSCASISQDKVLSESCDSDNLWICQKELKCECMCNGS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25192", 
            "resource": "KEGG Pathway", 
            "id": "rno:25192", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
            "annotation": "Existence of lectin-like genes in several poxviruses suggests that this may represent a common theme for viral evasion of innate immunity", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
                    "id": "NP_775414.2", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1#function", 
            "annotation": "Receptor for CLEC2D/OCIL. Ligand-binding contributes to inhibition of cytotoxic natural killer (NK) cells. May mediate MHC class I-independent 'missing-self' recognition of allografts, tumor cells and virus-infected cells.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4KWA1#function", 
                    "id": "A4KWA1", 
                    "database": "UniProtKB"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "P27471-1", 
            "protein_name": "Killer cell lectin-like receptor subfamily B member 1A", 
            "sequence": {
                "length": 223, 
                "sequence": "MDTARVYLSLKPSKTAAGAQCVSPPSLPPDACRCPRSHRLALKLSCAGLILLVLALVGMSILVRVLVQKPSVEPCRVLIQENLSKTGSPAKLKCPKDWLSHRDKCFHVSQTSITWKESLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDENWKWINGSTLNSDVLSITGDTEKDSCASVSQDKVLSESCDSDNIWVCQKELKCECMCNDS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/84369", 
                    "id": "84369", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Rat", 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "P27811-1", 
            "protein_name": "Killer cell lectin-like receptor subfamily B member 1A", 
            "sequence": {
                "length": 227, 
                "sequence": "MDTARVYFGLKPPRTPGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVVTLIGMSVLVRVLIQKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/84369", 
                    "id": "84369", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Mouse", 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }, 
        {
            "uniprot_canonical_ac": "P27814-1", 
            "protein_name": "Killer cell lectin-like receptor subfamily B member 1C", 
            "sequence": {
                "length": 223, 
                "sequence": "MDTASIYLGLKPPRTLGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVLTLIGMSVLVRVLVQKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/84369", 
                    "id": "84369", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Mouse", 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }, 
        {
            "uniprot_canonical_ac": "Q12918-1", 
            "protein_name": "Killer cell lectin-like receptor subfamily B member 1", 
            "sequence": {
                "length": 225, 
                "sequence": "MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSVSVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/84369", 
                    "id": "84369", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Human", 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb", 
            "label": "Isoforms"
        }, 
        {
            "name": "homologset.mgi", 
            "label": "MGI Homologs"
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
        "ac": "NP_775414.2", 
        "name": "killer cell lectin-like receptor subfamily B member 1B", 
        "summary": "signal transduction molecule [RGD, Feb 2006]."
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4KWA1", 
                                "id": "A4KWA1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "carbohydrate binding", 
                        "id": "GO:0030246"
                    }
                ], 
                "total": 1, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4KWA1", 
                                "id": "A4KWA1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "integral component of membrane", 
                        "id": "GO:0016021"
                    }
                ], 
                "total": 1, 
                "name": "Cellular Component"
            }
        ]
    }, 
    "gene_names": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A4KWA1", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Klrb1b"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Klrb1b"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A4KWA1", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Nkr-p1b; Nkrp1b"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "Nkrp1b"
        }
    ], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000007310", 
            "id": "ENSRNOG00000007310", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03593", 
            "id": "cd03593", 
            "database": "CDD"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/25192", 
            "id": "25192", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001304", 
            "id": "IPR001304", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR016186", 
            "id": "IPR016186", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR016187", 
            "id": "IPR016187", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR033992", 
            "id": "IPR033992", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25192", 
            "id": "rno:25192", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "http://www.orthodb.org/?query=1341815at2759", 
            "id": "1341815at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "https://www.rcsb.org/structure/5J2S", 
            "id": "5J2S", 
            "database": "PDB"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF00059", 
            "id": "PF00059", 
            "database": "Pfam"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_775414.2", 
            "id": "NP_775414.2", 
            "database": "RefSeq"
        }, 
        {
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2975", 
            "id": "2975", 
            "database": "RGD"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 24772.0, 
        "chemical_mass": 24772.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1", 
            "name": "Klrb1b", 
            "locus": {}
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "CD161 antigen-like family member B"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "F344"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A4KWA1", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Killer cell lectin-like receptor subfamily B member 1B allele A"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A4KWA1", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "killer cell lectin-like receptor subfamily B member 1B allele A; killer cell lectin-like receptor subfamily B member 1B allele C; klrb1b; CD161 antigen-like family member B; natural killer cell surface protein NKR-P1B allele TO; natural killer cell surface protein NKR-P1B allele RNK/SD/BN/F344"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A4KWA1", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "killer cell lectin-like receptor subfamily B member 1B"
        }
    ]
}