{ "uniprot_canonical_ac": "A1L3X0-1", "ptm_annotation": [], "sequence": { "header": "sp|A1L3X0-1|ELOV7_HUMAN Isoform 1 of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 281, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN" }, "uniprot_id": "ELOV7_HUMAN", "enzyme_annotation": [ { "ec": "2.3.1.199", "activity": "" }, { "ec": "2.3.1.199", "activity": "A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2)." } ], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/19826053", "type": [ "PubMed" ], "id": "19826053" } ], "title": "Novel lipogenic enzyme ELOVL7 is involved in prostate cancer growth through saturated long-chain fatty acid metabolism.", "journal": "Cancer Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Miki T., Nakamura Y., Furihata M., Kobayashi T., Nakagawa H., Shuin T., Chung S., Tamura K., Ashida S., Fujioka T., Hullin-Matsuda F., Makino A.", "date": "2009" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20937905", "type": [ "PubMed" ], "id": "20937905" } ], "title": "ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Igarashi Y., Kihara A., Ohno Y., Yamanaka M., Mitsutake S., Mizutani Y., Sassa T., Suto S.", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21959040", "type": [ "PubMed" ], "id": "21959040" } ], "title": "Biochemical characterization of the very long-chain fatty acid elongase ELOVL7.", "journal": "FEBS Lett.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Sato Y., Kihara A., Naganuma T., Ohno Y., Sassa T.", "date": "2011" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25732827", "type": [ "PubMed" ], "id": "25732827" } ], "title": "Fatty acid elongase 7 catalyzes lipidome remodeling essential for human cytomegalovirus replication.", "journal": "Cell reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Purdy JG, Shenk T, Rabinowitz JD", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27928700", "type": [ "PubMed" ], "id": "27928700" } ], "title": "Gene expression signatures for phlegm-dampness constitution of Chinese medicine.", "journal": "Science China. Life sciences", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Li L, Feng J, Yao H, Xie L, Chen Y, Yang L, Hou S, Zhao S, Sun R, Wu Y, Bai T, Li Y, Yu R, Wang J, Wang Q", "date": "2017" } ], "uniprot_ac": "A1L3X0", "site_annotation": [ { "end_pos": 275, "annotation": "n_glycosylation_sequon", "start_pos": 273 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0#A1L3X0-1", "isoform_ac": "A1L3X0-1", "locus": { "end_pos": 60754627, "strand": "+", "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000425382", "id": "ENST00000425382", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000402634", "id": "ENSP00000402634", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1L3X0-1|ELOV7_HUMAN Isoform 1 of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 281, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RBM2-1", "isoform_ac": "D6RBM2-1", "locus": { "end_pos": 60764231, "strand": "+", "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000511799", "id": "ENST00000511799", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000424081", "id": "ENSP00000424081", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RBM2-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 165, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFA" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RBR5-1", "isoform_ac": "D6RBR5-1", "locus": { "end_pos": 60768682, "strand": "+", "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000514809", "id": "ENST00000514809", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000422602", "id": "ENSP00000422602", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RBR5-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 88, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEILF" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RE10-1", "isoform_ac": "D6RE10-1", "locus": { "end_pos": 60767900, "strand": "+", "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000504455", "id": "ENST00000504455", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000425127", "id": "ENSP00000425127", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RE10-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 71, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITL" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RHD0-1", "isoform_ac": "D6RHD0-1", "locus": { "end_pos": 60754627, "strand": "+", "start_pos": 60784118, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000505959", "id": "ENST00000505959", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000421043", "id": "ENSP00000421043", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RHD0-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 268, "sequence": "MEKPINILYPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:79993", "resource": "KEGG Pathway", "id": "hsa:79993", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876", "resource": "Reactome", "id": "R-HSA-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0#function", "annotation": "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate in the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0#function", "id": "A1L3X0", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "Data show that ELOVL7, SOCS3, ACSL4 and CLU were upregulated while PRKAR1A and ABCG1 were downregulated in the phlegm-dampness group.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "ELOVL7 knockdown or mTOR inhibition impairs HCMV-induced fatty acid elongation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "Overexpression of ELOVL7 is associated with prostate cancer growth through saturated long-chain fatty acid metabolism.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "Progression of the VLCFA cycle enhances ELOVL7 activity.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "D4ADY9-1", "protein_name": "Elongation of very long chain fatty acids protein 7", "sequence": { "length": 281, "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/23672", "id": "23672", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q9D2Y9-1", "protein_name": "Elongation of very long chain fatty acids protein 7", "sequence": { "length": 281, "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/23672", "id": "23672", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "D", "start_pos": 27, "alt_nt": "A", "chr_id": "5", "ref_nt": "C", "chr_pos": "60067906", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "2.0", "sequence_mut": "Y", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 27, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "T", "start_pos": 38, "alt_nt": "C", "chr_id": "5", "ref_nt": "T", "chr_pos": "60067873", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:1324", "url": "http://disease-ontology.org/term/DOID:1324", "resource": "Disease Ontology", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "1.5", "sequence_mut": "A", "subjects_tested": "66", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.5%). In dbSNP: rs750549527.", "end_pos": 38, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "L", "start_pos": 77, "alt_nt": "G", "chr_id": "5", "ref_nt": "A", "chr_pos": "60067755", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "2.0", "sequence_mut": "P", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 77, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 98, "alt_nt": "A", "chr_id": "5", "ref_nt": "G", "chr_pos": "60063694", "disease": [ { "synonyms": [ { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterus neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "1.3", "sequence_mut": "*", "subjects_tested": "558", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.3%).", "end_pos": 98, "minor_allelic_frequency": "", "subjects_positive": "7" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "ac": "NP_001098028.1", "name": "elongation of very long chain fatty acids protein 7 isoform 1", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "pmid": "19826053", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongase activity", "id": "GO:0009922" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102336", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "3-oxo-arachidoyl-CoA synthase activity", "id": "GO:0102336" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102337", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "3-oxo-cerotoyl-CoA synthase activity", "id": "GO:0102337" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102338", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "3-oxo-lignoceronyl-CoA synthase activity", "id": "GO:0102338" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102756", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "very-long-chain 3-ketoacyl-CoA synthase activity", "id": "GO:0102756" } ], "total": 5, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "pmid": "20937905", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "endoplasmic reticulum", "id": "GO:0005783" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030176", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "integral component of endoplasmic reticulum membrane", "id": "GO:0030176" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "endoplasmic reticulum membrane", "id": "GO:0005789" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "sphingolipid biosynthetic process", "id": "GO:0030148" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "pmid": "20937905", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "pmid": "19826053", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "pmid": "20937905", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "pmid": "19826053", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035338", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "long-chain fatty-acyl-CoA biosynthetic process", "id": "GO:0035338" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006636", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "unsaturated fatty acid biosynthetic process", "id": "GO:0006636" } ], "total": 8, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L3X0", "type": "synonym", "resource": "RefSeq", "name": "ELOVL7" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "recommended", "resource": "UniProtKB", "name": "ELOVL7" } ], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ELOVL7", "id": "ELOVL7", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/79993", "id": "79993", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26292", "id": "26292", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1L3X0*", "id": "A1L3X0", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "id": "IPR002076", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR030457", "id": "IPR030457", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR033670", "id": "IPR033670", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:79993", "id": "hsa:79993", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/614451", "id": "614451", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A1L3X0", "id": "NX_A1L3X0", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/WLFYESC/", "id": "WLFYESC", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1094172at2759", "id": "1094172at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "id": "PTHR11157", "database": "PANTHER" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF118", "id": "PTHR11157:SF118", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF01151", "id": "PF01151", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A1L3X0", "id": "A1L3X0", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L3X0", "id": "PR_A1L3X0", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876", "id": "R-HSA-75876", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "Yes" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [ { "sequence_org": "H", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21959040", "id": "21959040", "database": "PubMed" } ], "sequence_mut": "A", "start_pos": 150, "end_pos": 150, "annotation": "Loss of activity; when associated with A-151." }, { "sequence_org": "H", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21959040", "id": "21959040", "database": "PubMed" } ], "sequence_mut": "A", "start_pos": 151, "end_pos": 151, "annotation": "Loss of activity; when associated with A-150." } ], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 33356.0, "chemical_mass": 33356.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "name": "ELOVL7", "locus": { "end_pos": 60751791, "strand": "-", "start_pos": 60844389, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000164181", "id": "ENSG00000164181", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "synonym", "resource": "UniProtKB", "name": "2.3.1.199" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "synonym", "resource": "UniProtKB", "name": "3-keto acyl-CoA synthase ELOVL7" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "synonym", "resource": "UniProtKB", "name": "ELOVL FA elongase 7" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "synonym", "resource": "UniProtKB", "name": "ELOVL fatty acid elongase 7" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "recommended", "resource": "UniProtKB", "name": "Elongation of very long chain fatty acids protein 7" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "synonym", "resource": "UniProtKB", "name": "Very long chain 3-ketoacyl-CoA synthase 7" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0", "type": "synonym", "resource": "UniProtKB", "name": "Very long chain 3-oxoacyl-CoA synthase 7" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L3X0", "type": "synonym", "resource": "RefSeq", "name": "elongation of very long chain fatty acids protein 7 isoform 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L3X0", "type": "synonym", "resource": "RefSeq", "name": "elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase ELOVL7; ELOVL FA elongase 7; very long chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids; very long chain 3-ketoacyl-CoA synthase 7" } ] }