{ "uniprot_canonical_ac": "A1L1L3-1", "ptm_annotation": [], "sequence": { "header": "sp|A1L1L3-1|PTN20_RAT Isoform 1 of Tyrosine-protein phosphatase non-receptor type 20 OS=Rattus norvegicus OX=10116 GN=Ptpn20 PE=1 SV=1 CANONICAL=A1L1L3-1", "length": 421, "sequence": "MSSPGNVRQKHGRDNDEHEGDSDDLNLQKSLPSSSQQKTPTKPVFGNKVNSESVKTSHHMSFSNKYDLVFPEPVESDNDETLWDVRDLSHRNRWSSVDPESAGPSKTVSTVLSESSTDTAVSERELTQLAQIRPLIFNSSSRAALRDCLKALQKKEELDIIREFLELEEMIPPDDFKSGYELQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEYFYIATQGPLPDTIEDFWQMVLENNCNVIAMITREIEGGVIKCCSYWPVSLKEPLEFKHFHVLLENFQITQYFVIRIFQIVKKSTGKSHSVKHLQFIKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFCTIEKNYSFNIMNIVTQMRKQRFGMIQTKEQYQFCYEIVLEVLQNLLALN" }, "uniprot_id": "PTN20_RAT", "enzyme_annotation": [ { "ec": "3.1.3.48", "activity": "" }, { "ec": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate." } ], "glycation": [], "keywords": [], "species": [ { "common_name": "Rat", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12477932", "type": [ "PubMed" ], "id": "12477932" } ], "title": "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073618.1", "id": "NP_001073618.1", "database": "RefSeq" } ], "authors": "Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16641100", "type": [ "PubMed" ], "id": "16641100" } ], "title": "Quantitative phosphoproteomics of vasopressin-sensitive renal cells: regulation of aquaporin-2 phosphorylation at two sites.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "authors": "Wang G., Shen R.F., Knepper M.A., Shen R.-F., Hoffert J.D., Pisitkun T.", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22673903", "type": [ "PubMed" ], "id": "22673903" } ], "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "authors": "Olsen J.V., Lage K., Secher A., Dmytriyev A., Lundby A., Lundby C., Nordsborg N.B.", "date": "2012" } ], "uniprot_ac": "A1L1L3", "site_annotation": [ { "end_pos": 140, "annotation": "n_glycosylation_sequon", "start_pos": 138 }, { "end_pos": 213, "annotation": "n_glycosylation_sequon", "start_pos": 211 }, { "end_pos": 379, "annotation": "n_glycosylation_sequon", "start_pos": 377 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3#A1L1L3-1", "isoform_ac": "A1L1L3-1", "locus": { "end_pos": 9917169, "strand": "-", "start_pos": 9971955, "chromosome": "16", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000027352", "id": "ENSRNOT00000027352", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000027352", "id": "ENSRNOP00000027352", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1L1L3-1|PTN20_RAT Isoform 1 of Tyrosine-protein phosphatase non-receptor type 20 OS=Rattus norvegicus OX=10116 GN=Ptpn20 PE=1 SV=1 CANONICAL=A1L1L3-1", "length": 421, "sequence": "MSSPGNVRQKHGRDNDEHEGDSDDLNLQKSLPSSSQQKTPTKPVFGNKVNSESVKTSHHMSFSNKYDLVFPEPVESDNDETLWDVRDLSHRNRWSSVDPESAGPSKTVSTVLSESSTDTAVSERELTQLAQIRPLIFNSSSRAALRDCLKALQKKEELDIIREFLELEEMIPPDDFKSGYELQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEYFYIATQGPLPDTIEDFWQMVLENNCNVIAMITREIEGGVIKCCSYWPVSLKEPLEFKHFHVLLENFQITQYFVIRIFQIVKKSTGKSHSVKHLQFIKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFCTIEKNYSFNIMNIVTQMRKQRFGMIQTKEQYQFCYEIVLEVLQNLLALN" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:306281", "resource": "KEGG Pathway", "id": "rno:306281", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3#function", "annotation": "Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3#function", "id": "A1L1L3", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "O55082-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 20", "sequence": { "length": 426, "sequence": "MSSPRKVRGKTGRDNDEEEGNSGNLNLRNSLPSSSQKMTPTKPIFGNKMNSENVKPSHHLSFSDKYELVYPEPLESDTDETVWDVSDRSLRNRWNSMDSETAGPSKTVSPVLSGSSRLSKDTETSVSEKELTQLAQIRPLIFNSSARSAMRDCLNTLQKKEELDIIREFLELEQMTLPDDFNSGNTLQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEYFYIATQGPLPETIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLETFHVTQYFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFSAIEKNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVLQNLLALY" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A1L1L3/", "id": "A1L1L3", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/74905", "id": "74905", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q4JDL3-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 20", "sequence": { "length": 420, "sequence": "MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A1L1L3/", "id": "A1L1L3", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/74905", "id": "74905", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073618.1", "ac": "NP_001073618.1", "name": "tyrosine-protein phosphatase non-receptor type 20", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004725", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "name": "protein tyrosine phosphatase activity", "id": "GO:0004725" } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005874", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "name": "microtubule", "id": "GO:0005874" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005815", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "name": "microtubule organizing center", "id": "GO:0005815" } ], "total": 4, "name": "Cellular Component" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L3", "type": "synonym", "resource": "RefSeq", "name": "Ptpn20b" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L3", "type": "synonym", "resource": "RefSeq", "name": "Ptpn20" }, { "url": "https://www.uniprot.org/uniprot/A1L1L3", "type": "recommended", "resource": "UniProtKB", "name": "Ptpn20" } ], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000020203", "id": "ENSRNOG00000020203", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/306281", "id": "306281", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000242", "id": "IPR000242", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000387", "id": "IPR000387", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003595", "id": "IPR003595", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR016130", "id": "IPR016130", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029021", "id": "IPR029021", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:306281", "id": "rno:306281", "database": "KEGG Pathway" }, { "url": "https://omabrowser.org/oma/group/KHLQFTN/", "id": "KHLQFTN", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=411281at2759", "id": "411281at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF00102", "id": "PF00102", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L1L3", "id": "PR_A1L1L3", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073618.1", "id": "NP_001073618.1", "database": "RefSeq" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1309812", "id": "1309812", "database": "RGD" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "position": "122", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16641100", "id": "16641100", "database": "PubMed" } ], "kinase_uniprot_canonical_ac": "Q703I1-1", "kinase_gene_name": "Oser1" }, { "residue": "Ser", "position": "122", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" }, { "residue": "Ser", "position": "76", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22673903", "id": "22673903", "database": "PubMed" } ], "kinase_uniprot_canonical_ac": "Q703I1-1", "kinase_gene_name": "Oser1" }, { "residue": "Ser", "position": "76", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "id": "A1L1L3", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" } ], "mass": { "monoisotopic_mass": 48580.0, "chemical_mass": 48580.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "name": "Ptpn20", "locus": { "end_pos": 9973516, "strand": "+", "start_pos": 9907598, "chromosome": "16", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000020203", "id": "ENSRNOG00000020203", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1L1L3", "type": "synonym", "resource": "UniProtKB", "name": "3.1.3.48" }, { "url": "https://www.uniprot.org/uniprot/A1L1L3", "type": "recommended", "resource": "UniProtKB", "name": "Tyrosine-protein phosphatase non-receptor type 20" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L3", "type": "synonym", "resource": "RefSeq", "name": "protein tyrosine phosphatase, non-receptor type 20B" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L3", "type": "synonym", "resource": "RefSeq", "name": "tyrosine-protein phosphatase non-receptor type 20" } ] }