{ "uniprot_canonical_ac": "A0PJZ3-1", "ptm_annotation": [], "sequence": { "header": "sp|A0PJZ3-1|GXLT2_HUMAN Isoform 1 of Glucoside xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=GXYLT2 PE=2 SV=2 CANONICAL=A0PJZ3-1", "length": 443, "sequence": "MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKLARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKLLRLFNSTQLAAMAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCREAEHEGVSVLHGNRGVYHDDKQPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQIEKTMKRAYEKHVIIHVGPNQMH" }, "uniprot_id": "GXLT2_HUMAN", "enzyme_annotation": [ { "ec": "2.4.2.42", "activity": "" }, { "ec": "2.4.2.42", "activity": "UDP-alpha-D-xylose + Glc-beta-Ser(53)-EGF-like domain of bovine factor IX(45-87) = UDP + Xyl-alpha(1-3)Glc-beta-Ser(53)-EGF-like domain of bovine factor IX(45-87)." } ], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "predicted.uniprotkb_gly" ], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "id": "A0PJZ3", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/19940119", "type": [ "PubMed" ], "id": "19940119" } ], "title": "Identification of glycosyltransferase 8 family members as xylosyltransferases acting on O-glucosylated notch epidermal growth factor repeats.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "id": "A0PJZ3", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073862.1", "id": "NP_001073862.1", "database": "RefSeq" } ], "authors": "Haltiwanger R.S., Bakker H., Buettner F.F., Takeuchi H., Gerardy-Schahn R., Krylov V.B., Nifantiev N.E., Sethi M.K.", "date": "2010" } ], "uniprot_ac": "A0PJZ3", "site_annotation": [ { "end_pos": 235, "annotation": "n_glycosylation_sequon", "start_pos": 233 }, { "end_pos": 276, "annotation": "n_glycosylation_sequon", "start_pos": 274 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3#A0PJZ3-1", "isoform_ac": "A0PJZ3-1", "locus": { "end_pos": 72888234, "strand": "-", "start_pos": 72975156, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000389617", "id": "ENST00000389617", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000374268", "id": "ENSP00000374268", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0PJZ3-1|GXLT2_HUMAN Isoform 1 of Glucoside xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=GXYLT2 PE=2 SV=2 CANONICAL=A0PJZ3-1", "length": 443, "sequence": "MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKLARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKLLRLFNSTQLAAMAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCREAEHEGVSVLHGNRGVYHDDKQPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQIEKTMKRAYEKHVIIHVGPNQMH" } }, { "url": "https://www.uniprot.org/uniprot/A0PJZ3#C9J3Q6-1", "isoform_ac": "C9J3Q6-1", "locus": { "end_pos": 72908470, "strand": "-", "start_pos": 72955181, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000498315", "id": "ENST00000498315", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000417239", "id": "ENSP00000417239", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|C9J3Q6-1|GXLT2_HUMAN Computationally mapped isoform of Glucoside xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=GXYLT2 PE=2 SV=1 CANONICAL=A0PJZ3-1", "length": 102, "sequence": "MLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKL" } }, { "url": "https://www.uniprot.org/uniprot/A0PJZ3#C9JND4-1", "isoform_ac": "C9JND4-1", "locus": { "end_pos": 72955215, "strand": "-", "start_pos": 72998136, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000491839", "id": "ENST00000491839", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000420426", "id": "ENSP00000420426", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|C9JND4-1|GXLT2_HUMAN Computationally mapped isoform of Glucoside xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=GXYLT2 PE=2 SV=1 CANONICAL=A0PJZ3-1", "length": 164, "sequence": "MAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCREAEHEGVSVLHGNRGVYHDDKQPTFRALYEAIRDILRRGGKRKFVLSWISFFVM" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:727936", "resource": "KEGG Pathway", "id": "hsa:727936", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3#function", "annotation": "Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3#function", "id": "A0PJZ3", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073862.1", "annotation": "We have identified two enzymes of the human glycosyltransferase 8 family, now named GXYLT1 and GXYLT2 (glucoside xylosyltransferase), as UDP-d-xylose:beta-d-glucoside alpha1,3-d-xylosyltransferases adding the first xylose.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073862.1", "id": "NP_001073862.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "D4A275-1", "protein_name": "Glucoside xylosyltransferase 2", "sequence": { "length": 444, "sequence": "MKLRSKAAALLLLALAVLLLALLSLRARQDLEPPGFPARPEAAPQRRHAPVPTLPPEPRAFPGAAGPRFPRRRPPRLRPGASRPRAASRGKLARRSGEVRSLHSVPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKMRFHIFTEDALKPEFDKQLRQWPDSYTKKFEHKLYPITFSVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKLLRQFNSTQLAAMAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRSTQFKNSLIPTGLAWEEMLLPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCKEAEREGVSVLHGNRGVYHDDKQPTFRALYEAIRDFPFRDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQIEKTMRRAYEKHIVIHVGPNPMS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/16823", "id": "16823", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A0PJZ3/", "id": "A0PJZ3", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q810K9-1", "protein_name": "Glucoside xylosyltransferase 2", "sequence": { "length": 444, "sequence": "MKLRSKAAALLLLALAVLLLALLSLRARRDPEPPGFPARPEAAPQRRHAPVPTLPPEPRAFPGAAGRRSPRRQPPRLRPRAGRPRAASREKLARRPGETRSLHSVPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKMRFHIFTEDALKPEFDKQLRQWPDSYTKKFEHRLYPITFSVGNPQEWKKLFKPCAAQRLFLPAILKDVDSLLYVDTDVLFLRPVDDIWKLLRQFNSTQLAAMAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRNTQFKNSLIPAGLAWEEMLLPLYQKYKSAITWGDQDLLNIIFYYNPECLYVFPCQWNYRPDHCMYGSNCKEAEREGVSVLHGNRGVYHDDKQPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQIEKTMRRAYEKHVIIHMGPNPMS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/16823", "id": "16823", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A0PJZ3/", "id": "A0PJZ3", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "W", "start_pos": 160, "alt_nt": "C", "chr_id": "3", "ref_nt": "G", "chr_pos": "72971365", "disease": [ { "synonyms": [ { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "tumor of the Ovary", "description": "" } ], "recommended_name": { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0PJZ3", "id": "A0PJZ3", "database": "BioMuta" } ], "frequency": "1.1", "sequence_mut": "S", "subjects_tested": "93", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "end_pos": 160, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "Y", "alt_nt": "A", "chr_id": "3", "ref_nt": "T", "chr_pos": "72955278", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772953155", "id": "rs772953155", "database": "dbSNP" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772953155", "id": "rs772953155", "database": "ExAC" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs772953155", "id": "rs772953155", "database": "gnomAD" } ], "sequence_mut": "N", "start_pos": 261, "keywords": [ "ebi", "germline" ], "end_pos": 261, "minor_allelic_frequency": "", "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YGS->NGS)." }, { "sequence_org": "A", "start_pos": 293, "alt_nt": "A", "chr_id": "3", "ref_nt": "G", "chr_pos": "73006404", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0PJZ3", "id": "A0PJZ3", "database": "BioMuta" } ], "frequency": "2.0", "sequence_mut": "T", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 293, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073862.1", "ac": "NP_001073862.1", "name": "glucoside xylosyltransferase 2 precursor", "summary": "The protein encoded by this gene is a xylosyltransferase that elongates O-linked glucose bound to epidermal growth factor (EGF) repeats. The encoded protein catalyzes the addition of xylose to the O-glucose-modified residues of EGF repeats of Notch proteins. [provided by RefSeq, Sep 2016]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035252", "pmid": "19940119", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "id": "A0PJZ3", "database": "UniProtKB" } ], "name": "UDP-xylosyltransferase activity", "id": "GO:0035252" } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "id": "A0PJZ3", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016266", "pmid": "19940119", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "id": "A0PJZ3", "database": "UniProtKB" } ], "name": "O-glycan processing", "id": "GO:0016266" } ], "total": 1, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A0PJZ3", "type": "synonym", "resource": "RefSeq", "name": "GLT8D4" }, { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "type": "synonym", "resource": "UniProtKB", "name": "GLT8D4" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0PJZ3", "type": "synonym", "resource": "RefSeq", "name": "GXYLT2" }, { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "type": "recommended", "resource": "UniProtKB", "name": "GXYLT2" } ], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0PJZ3", "id": "A0PJZ3", "database": "BioMuta" }, { "url": "http://www.cazy.org/fam/GT8.html", "id": "GT8", "database": "CAZy" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GXYLT2", "id": "GXYLT2", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/727936", "id": "727936", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=33383", "id": "33383", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A0PJZ3*", "id": "A0PJZ3", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR002495", "id": "IPR002495", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "id": "IPR029044", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:727936", "id": "hsa:727936", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/613322", "id": "613322", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A0PJZ3", "id": "NX_A0PJZ3", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/YKNHITW/", "id": "YKNHITW", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=978446at2759", "id": "978446at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF01501", "id": "PF01501", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A0PJZ3", "id": "A0PJZ3", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0PJZ3", "id": "PR_A0PJZ3", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073862.1", "id": "NP_001073862.1", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "Yes" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0PJZ3", "id": "A0PJZ3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [ { "residue": "Asn", "site_category": "predicted", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3#ptm_processing", "id": "A0PJZ3", "database": "UniProtKB" } ], "subtype": "", "relation": "attached", "position": 233, "glytoucan_ac": "", "type": "N-linked" }, { "residue": "Asn", "site_category": "predicted", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3#ptm_processing", "id": "A0PJZ3", "database": "UniProtKB" } ], "subtype": "", "relation": "attached", "position": 274, "glytoucan_ac": "", "type": "N-linked" } ], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 51056.0, "chemical_mass": 51056.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000172986", "id": "ENSG00000172986", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "name": "GXYLT2", "locus": { "end_pos": 72998138, "strand": "+", "start_pos": 72888073, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000172986", "id": "ENSG00000172986", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "type": "synonym", "resource": "UniProtKB", "name": "2.4.2.42" }, { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "type": "recommended", "resource": "UniProtKB", "name": "Glucoside xylosyltransferase 2" }, { "url": "https://www.uniprot.org/uniprot/A0PJZ3", "type": "synonym", "resource": "UniProtKB", "name": "Glycosyltransferase 8 domain-containing protein 4" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0PJZ3", "type": "synonym", "resource": "RefSeq", "name": "glucoside xylosyltransferase 2 precursor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0PJZ3", "type": "synonym", "resource": "RefSeq", "name": "glycosyltransferase 8 domain containing 4; glycosyltransferase 8 domain-containing protein 4" } ] }