{ "uniprot_canonical_ac": "A0JLT2-1", "ptm_annotation": [], "sequence": { "header": "sp|A0JLT2-1|MED19_HUMAN Isoform 1 of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2 CANONICAL=A0JLT2-1", "length": 244, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" }, "uniprot_id": "MED19_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12584197", "type": [ "PubMed" ], "id": "12584197" } ], "title": "Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Cai Y., Conaway J.W., Conaway R.C., Jin J., Lane W.S., Parmely T.J., Sato S., Sorokina I., Tomomori-Sato C., Banks C.A.S., Brower C.S., Kong S.E.", "date": "2003" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/14638676", "type": [ "PubMed" ], "id": "14638676" } ], "title": "A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Tomomori-Sato C, Sato S, Parmely TJ, Banks CA, Sorokina I, Florens L, Zybailov B, Washburn MP, Brower CS, Conaway RC, Conaway JW", "date": "2004" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/15175163", "type": [ "PubMed" ], "id": "15175163" } ], "title": "A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.", "journal": "Mol. Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "authors": "Cai Y., Conaway J.W., Conaway R.C., Florens L., Jin J., Parmely T.J., Sato S., Swanson S.K., Tomomori-Sato C., Washburn M.P., Banks C.A.S., Zybailov B.", "date": "2004" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17081983", "type": [ "PubMed" ], "id": "17081983" } ], "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "authors": "Blagoev B., Gnad F., Kumar C., Macek B., Mann M., Mortensen P., Olsen J.V.", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27572702", "type": [ "PubMed" ], "id": "27572702" } ], "title": "Med19 promotes breast cancer cell proliferation by regulating CBFA2T3/HEB expression.", "journal": "Breast cancer (Tokyo, Japan)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Zhang X, Fan Y, Liu B, Qi X, Guo Z, Li L", "date": "2017" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27811858", "type": [ "PubMed" ], "id": "27811858" } ], "title": "The FOXD3/miR-214/MED19 axis suppresses tumour growth and metastasis in human colorectal cancer.", "journal": "British journal of cancer", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "He GY, Hu JL, Zhou L, Zhu XH, Xin SN, Zhang D, Lu GF, Liao WT, Ding YQ, Liang L", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28125713", "type": [ "PubMed" ], "id": "28125713" } ], "title": "Knockdown of Mediator Complex Subunit 19 Suppresses the Growth and Invasion of Prostate Cancer Cells.", "journal": "PloS one", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Yu S, Wang Y, Yuan H, Zhao H, Lv W, Chen J, Wan F, Liu D, Gao Z, Wu J", "date": "2017" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28631286", "type": [ "PubMed" ], "id": "28631286" } ], "title": "Knockdown of mediator subunit Med19 suppresses bladder cancer cell proliferation and migration by downregulating Wnt/beta-catenin signalling pathway.", "journal": "Journal of cellular and molecular medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Yuan H, Yu S, Cui Y, Men C, Yang D, Gao Z, Zhu Z, Wu J", "date": "2017" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28765911", "type": [ "PubMed" ], "id": "28765911" } ], "title": "LCMR1 interacts with DEK to suppress apoptosis in lung cancer cells.", "journal": "Molecular medicine reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Xu Y, Liang Z, Li C, Yang Z, Chen L", "date": "2017" } ], "uniprot_ac": "A0JLT2", "site_annotation": [ { "end_pos": 126, "annotation": "n_glycosylation_sequon", "start_pos": 124 }, { "end_pos": 5, "annotation": "n_glycosylation_sequon", "start_pos": 3 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0A494C0G4-1", "isoform_ac": "A0A494C0G4-1", "locus": { "end_pos": 57704625, "strand": "+", "start_pos": 57712230, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000650677", "id": "ENST00000650677", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000498522", "id": "ENSP00000498522", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A494C0G4-1|MED19_HUMAN Computationally mapped isoform of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=1 CANONICAL=A0JLT2-1", "length": 211, "sequence": "MKITNGRHGDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0A494C0Y4-1", "isoform_ac": "A0A494C0Y4-1", "locus": { "end_pos": 57704041, "strand": "+", "start_pos": 57712230, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000650726", "id": "ENST00000650726", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000498791", "id": "ENSP00000498791", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A494C0Y4-1|MED19_HUMAN Computationally mapped isoform of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=1 CANONICAL=A0JLT2-1", "length": 261, "sequence": "MKITNGRHGDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0JLT2-1", "isoform_ac": "A0JLT2-1", "locus": {}, "sequence": { "header": "sp|A0JLT2-1|MED19_HUMAN Isoform 1 of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2 CANONICAL=A0JLT2-1", "length": 244, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0JLT2-2", "isoform_ac": "A0JLT2-2", "locus": { "end_pos": 57704625, "strand": "+", "start_pos": 57712179, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000337672", "id": "ENST00000337672", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000337340", "id": "ENSP00000337340", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0JLT2-2|MED19_HUMAN Isoform 2 of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2 CANONICAL=A0JLT2-1", "length": 194, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#J3KR33-1", "isoform_ac": "J3KR33-1", "locus": { "end_pos": 57704041, "strand": "+", "start_pos": 57712179, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000431606", "id": "ENST00000431606", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000416227", "id": "ENSP00000416227", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|J3KR33-1|MED19_HUMAN Computationally mapped isoform of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=3 CANONICAL=A0JLT2-1", "length": 244, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:219541", "resource": "KEGG Pathway", "id": "hsa:219541", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "id": "R-HSA-1989781", "name": "PPARA activates gene expression" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2#function", "annotation": "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2#function", "id": "A0JLT2", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "DEK and LCMR1 were demonstrated to cooperate in the inhibition of apoptosis in lung cancer cells.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "FOXD3/miR-214/MED19 axis is important for the regulation of growth, invasion and metastasis of colorectal cancer", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "Med19 promotes breast cancer cell proliferation and that this effect is associated with regulating CBFA2T3 and HEB expression.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "The data suggest that Med19 expression correlates with aggressive characteristics of bladder cancer, and Med19 knockdown suppresses the proliferation and migration of cancer cells through down-regulating the Wnt/beta-catenin pathway.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "We knocked down the Med19 expression in prostate cancer cell lines LNCaP and PC3 by using lentivirus siRNA. Cell proliferation, anchor-independent growth, migration, and invasion were suppressed in Med19 knockdown prostate cancer cells. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZAP1-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "sequence": { "length": 244, "sequence": "MENFTALFGAQTDPPPPPSALGFGPGKPPPPPPPPPGGGPGTAPPSTATSAPVGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/14684", "id": "14684", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q8C1S0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "sequence": { "length": 244, "sequence": "MENFTALFGAQTDPPPPPSALGFGPGKPPPPPPPPPGGGPGAAPPSTATSAPAGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/14684", "id": "14684", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "ac": "NP_001304007.1", "name": "mediator of RNA polymerase II transcription subunit 19 isoform 1", "summary": "The protein encoded by this gene is a subunit of the Mediator complex, which binds to gene-specific regulatory factors and provides support for the basal RNA polymerase II transcription machinery. This gene has been implicated in the growth of several types of cancer, and inhibition of its expression inhibits the growth and spread of these cancers. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008134", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "transcription factor binding", "id": "GO:0008134" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003712", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "transcription coregulator activity", "id": "GO:0003712" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016592", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "mediator complex", "id": "GO:0016592" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "nuclear body", "id": "GO:0016604" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944" } ], "total": 1, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JLT2", "type": "synonym", "resource": "RefSeq", "name": "DT2P1G7; LCMR1; MED19AS" }, { "url": "https://www.uniprot.org/uniprot/A0JLT2", "type": "synonym", "resource": "UniProtKB", "name": "LCMR1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JLT2", "type": "synonym", "resource": "RefSeq", "name": "MED19" }, { "url": "https://www.uniprot.org/uniprot/A0JLT2", "type": "recommended", "resource": "UniProtKB", "name": "MED19" } ], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0JLT2", "id": "A0JLT2", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MED19", "id": "MED19", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/219541", "id": "219541", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=29600", "id": "29600", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A0JLT2*", "id": "A0JLT2", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR019403", "id": "IPR019403", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:219541", "id": "hsa:219541", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/612385", "id": "612385", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A0JLT2", "id": "NX_A0JLT2", "database": "neXtProt" }, { "url": "http://www.orthodb.org/?query=106971at2759", "id": "106971at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22536", "id": "PTHR22536", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF10278", "id": "PF10278", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A0JLT2", "id": "A0JLT2", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0JLT2", "id": "PR_A0JLT2", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "id": "R-HSA-1989781", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "id": "R-HSA-381340", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "Yes" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "position": "194", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23186163", "id": "23186163", "database": "PubMed" } ], "kinase_uniprot_canonical_ac": "Q6P1J9-1", "kinase_gene_name": "CDC73" }, { "residue": "Ser", "position": "194", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" }, { "residue": "Ser", "position": "226", "evidence": [ { "url": "http://phospho.elm.eu.org/byAccession/A0JLT2.html", "id": "A0JLT2", "database": "phospho.ELM" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17081983", "id": "17081983", "database": "PubMed" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18669648", "id": "18669648", "database": "PubMed" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20068231", "id": "20068231", "database": "PubMed" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23186163", "id": "23186163", "database": "PubMed" } ], "kinase_uniprot_canonical_ac": "Q6P1J9-1", "kinase_gene_name": "CDC73" }, { "residue": "Ser", "position": "226", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "" } ], "mass": { "monoisotopic_mass": 26273.0, "chemical_mass": 26273.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "name": "MED19", "locus": { "end_pos": 57703714, "strand": "-", "start_pos": 57712323, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000156603", "id": "ENSG00000156603", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "type": "synonym", "resource": "UniProtKB", "name": "Lung cancer metastasis-related protein 1" }, { "url": "https://www.uniprot.org/uniprot/A0JLT2", "type": "synonym", "resource": "UniProtKB", "name": "Mediator complex subunit 19" }, { "url": "https://www.uniprot.org/uniprot/A0JLT2", "type": "recommended", "resource": "UniProtKB", "name": "Mediator of RNA polymerase II transcription subunit 19" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JLT2", "type": "synonym", "resource": "RefSeq", "name": "lung cancer metastasis-related protein 1; mediator of RNA polymerase II transcription subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog; putative mediator subunit MED19AS protein" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JLT2", "type": "synonym", "resource": "RefSeq", "name": "mediator of RNA polymerase II transcription subunit 19 isoform 1" } ] }