{ "uniprot_canonical_ac": "A5PLL7-1", "ptm_annotation": [], "sequence": { "header": "sp|A5PLL7-1|TM189_HUMAN Isoform 1 of Transmembrane protein 189 OS=Homo sapiens OX=9606 GN=TMEM189 PE=1 SV=3 CANONICAL=A5PLL7-1", "length": 270, "sequence": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK" }, "uniprot_id": "TM189_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "id": "A5PLL7", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11076860", "type": [ "PubMed" ], "id": "11076860" } ], "title": "Fusion of the human gene for the polyubiquitination coeffector UEV1 with Kua, a newly identified gene.", "journal": "Genome Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "id": "A5PLL7", "database": "UniProtKB" } ], "authors": "Carrio R., Merino J., Guigo R., Cormand B., Macaya A., Valeri M., Thomson T.M., Diaz V.M., Lozano J.J., Loukili N., Abril J., Burset M., Corominas M., Serras F.", "date": "2000" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11280764", "type": [ "PubMed" ], "id": "11280764" } ], "title": "Molecular basis of T cell-mediated recognition of pancreatic cancer cells.", "journal": "Cancer Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "id": "A5PLL7", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001155977.1", "id": "NP_001155977.1", "database": "RefSeq" } ], "authors": "Ito M., Itoh K., Shichijo S., Harashima N., Ochi M., Saito N., Tsuda N.", "date": "2001" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21048031", "type": [ "PubMed" ], "id": "21048031" } ], "title": "Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.", "journal": "Haematologica", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001155977.1", "id": "NP_001155977.1", "database": "RefSeq" } ], "authors": "Casabonne D, Reina O, Benavente Y, Becker N, Maynadie M, Foretova L, Cocco P, Gonzalez-Neira A, Nieters A, Boffetta P, Middeldorp JM, de Sanjose S", "date": "2011" } ], "uniprot_ac": "A5PLL7", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7#A5PLL7-1", "isoform_ac": "A5PLL7-1", "locus": { "end_pos": 50125061, "strand": "+", "start_pos": 50153637, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000371652", "id": "ENST00000371652", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000360715", "id": "ENSP00000360715", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A5PLL7-1|TM189_HUMAN Isoform 1 of Transmembrane protein 189 OS=Homo sapiens OX=9606 GN=TMEM189 PE=1 SV=3 CANONICAL=A5PLL7-1", "length": 270, "sequence": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK" } }, { "url": "https://www.uniprot.org/uniprot/A5PLL7#A5PLL7-2", "isoform_ac": "A5PLL7-2", "locus": { "end_pos": 50125061, "strand": "+", "start_pos": 50153637, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000371650", "id": "ENST00000371650", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000360713", "id": "ENSP00000360713", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A5PLL7-2|TM189_HUMAN Isoform 2 of Transmembrane protein 189 OS=Homo sapiens OX=9606 GN=TMEM189 PE=1 SV=3 CANONICAL=A5PLL7-1", "length": 267, "sequence": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK" } }, { "url": "https://www.uniprot.org/uniprot/A5PLL7#F8W924-1", "isoform_ac": "F8W924-1", "locus": { "end_pos": 50129659, "strand": "+", "start_pos": 50153637, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000371658", "id": "ENST00000371658", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000360721", "id": "ENSP00000360721", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|F8W924-1|TM189_HUMAN Computationally mapped isoform of Transmembrane protein 189 OS=Homo sapiens OX=9606 GN=TMEM189 PE=1 SV=1 CANONICAL=A5PLL7-1", "length": 91, "sequence": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVGFHPTLPGAPH" } }, { "url": "https://www.uniprot.org/uniprot/A5PLL7#F8WBY2-1", "isoform_ac": "F8WBY2-1", "locus": { "end_pos": 50151302, "strand": "+", "start_pos": 50153637, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000453505", "id": "ENST00000453505", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000411045", "id": "ENSP00000411045", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|F8WBY2-1|TM189_HUMAN Computationally mapped isoform of Transmembrane protein 189 OS=Homo sapiens OX=9606 GN=TMEM189 PE=1 SV=1 CANONICAL=A5PLL7-1", "length": 45, "sequence": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPVPFTL" } }, { "url": "https://www.uniprot.org/uniprot/A5PLL7#Q5TGE2-1", "isoform_ac": "Q5TGE2-1", "locus": { "end_pos": 50125061, "strand": "+", "start_pos": 50131035, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000371656", "id": "ENST00000371656", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000360719", "id": "ENSP00000360719", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|Q5TGE2-1|TM189_HUMAN Computationally mapped isoform of Transmembrane protein 189 OS=Homo sapiens OX=9606 GN=TMEM189 PE=1 SV=1 CANONICAL=A5PLL7-1", "length": 195, "sequence": "MNERAIAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:387521", "resource": "KEGG Pathway", "id": "hsa:387521", "name": "" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:387522", "resource": "KEGG Pathway", "id": "hsa:387522", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001155977.1", "annotation": "Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001155977.1", "id": "NP_001155977.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JUA8-1", "protein_name": "Transmembrane protein 189", "sequence": { "length": 258, "sequence": "NGCLAQSSAAVEAPAACASRSPPLPLPTGKRLQEWCSVILCFSLIAHNSVHLLLLARWEHTPLVILGVVAGALVADFLSGLVHWGADTWGSVDLPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFQTQSPETLEQLYPWECFVFCLIIFGTFTNQIHKWSHTYLGLPCWVTVLQDWHVILPRKHHRIHHVAPHETYFCITTGWLNYPLEVIGFWRRLEDVIQSLTGEKPRADDMKWAQKIK" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A5PLL7/", "id": "A5PLL7", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q99LQ7-1", "protein_name": "Transmembrane protein 189", "sequence": { "length": 271, "sequence": "MAGAEDAPGRQPELDEDETAEGRRWGAQHAGARELAALYSPGKRFQEWCSVILCFSLIAHNLVHLLLLARWEHTPLVILGVVAGALVADFLSGLVHWGADTWGSVDLPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTQSPETLEQLYPWECFVFCLTIFGTFTNQIHKWSHTYLGLPYWVTVLQDWHVILPRKHHRIHHVAPHETYFCITTGWLNYPLEVIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/33615", "id": "33615", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A5PLL7/", "id": "A5PLL7", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "A", "start_pos": 2, "alt_nt": "A", "chr_id": "20", "ref_nt": "G", "chr_pos": "48770170", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A5PLL7", "id": "A5PLL7", "database": "BioMuta" } ], "frequency": "2.0", "sequence_mut": "V", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 2, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001155977.1", "ac": "NP_001155977.1", "name": "transmembrane protein 189 isoform 2", "summary": "Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "id": "A5PLL7", "database": "UniProtKB" } ], "name": "endoplasmic reticulum", "id": "GO:0005783" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "id": "A5PLL7", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "id": "A5PLL7", "database": "UniProtKB" } ], "name": "endoplasmic reticulum membrane", "id": "GO:0005789" } ], "total": 3, "name": "Cellular Component" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A5PLL7", "type": "synonym", "resource": "RefSeq", "name": "KUA" }, { "url": "https://www.uniprot.org/uniprot/A5PLL7", "type": "synonym", "resource": "UniProtKB", "name": "KUA" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A5PLL7", "type": "synonym", "resource": "RefSeq", "name": "TMEM189" }, { "url": "https://www.uniprot.org/uniprot/A5PLL7", "type": "recommended", "resource": "UniProtKB", "name": "TMEM189" } ], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A5PLL7", "id": "A5PLL7", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TMEM189", "id": "TMEM189", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/387521", "id": "387521", "database": "GeneID" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/387522", "id": "387522", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16735", "id": "16735", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A5PLL7*", "id": "A5PLL7", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR019547", "id": "IPR019547", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:387521", "id": "hsa:387521", "database": "KEGG Pathway" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:387522", "id": "hsa:387522", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/610994", "id": "610994", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A5PLL7", "id": "NX_A5PLL7", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/RTQECIC/", "id": "RTQECIC", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1462707at2759", "id": "1462707at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF10520", "id": "PF10520", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A5PLL7", "id": "A5PLL7", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A5PLL7", "id": "PR_A5PLL7", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001155977.1", "id": "NP_001155977.1", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "Yes" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "Yes" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5PLL7", "id": "A5PLL7", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "Yes" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 31135.0, "chemical_mass": 31135.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240849", "id": "ENSG00000240849", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "name": "TMEM189", "locus": { "end_pos": 50118254, "strand": "-", "start_pos": 50153734, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000240849", "id": "ENSG00000240849", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A5PLL7", "type": "recommended", "resource": "UniProtKB", "name": "Transmembrane protein 189" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A5PLL7", "type": "synonym", "resource": "RefSeq", "name": "transmembrane protein 189 isoform 2" } ] }