{ "uniprot_canonical_ac": "A2AVB8-1", "sequence": { "header": "tr|A2AVB8-1|A2AVB8_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1107 PE=3 SV=1 CANONICAL=A2AVB8-1", "length": 312, "sequence": "MRVWNHTGVKEFMLLGLTENPNCQVPLFLLFSIVYLIILVGNWGMIILIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLIDFLSEHKSSTFFGCVLQSFFFAVYITTEGILLSMMAYDRYVAIANPLMYTVIMTHRICSQMVLACYLGGLINSLTHTIGLLRLDFCGPNIVNHFFCDIPPLLKLACSDAHNNEMLLLVFSGVIAIFTFIIVMVSYIHIIIAILRIRSAEGRRKAFSTCASHLTAVILFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAKKFIGRERRTS" }, "uniprot_id": "A2AVB8_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [], "uniprot_ac": "A2AVB8", "site_annotation": [ { "end_pos": 67, "annotation": "n_glycosylation_sequon", "start_pos": 65 }, { "end_pos": 7, "annotation": "n_glycosylation_sequon", "start_pos": 5 } ], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8#A2AVB8-1", "isoform_ac": "A2AVB8-1", "locus": { "end_pos": 87071197, "start_pos": 87072132, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000214049", "id": "ENSMUST00000214049", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000150135", "id": "ENSMUSP00000150135", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A2AVB8-1|A2AVB8_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1107 PE=3 SV=1 CANONICAL=A2AVB8-1", "length": 312, "sequence": "MRVWNHTGVKEFMLLGLTENPNCQVPLFLLFSIVYLIILVGNWGMIILIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLIDFLSEHKSSTFFGCVLQSFFFAVYITTEGILLSMMAYDRYVAIANPLMYTVIMTHRICSQMVLACYLGGLINSLTHTIGLLRLDFCGPNIVNHFFCDIPPLLKLACSDAHNNEMLLLVFSGVIAIFTFIIVMVSYIHIIIAILRIRSAEGRRKAFSTCASHLTAVILFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAKKFIGRERRTS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258841", "resource": "KEGG Pathway", "id": "mmu:258841", "name": "" } ], "function": [], "orthologs": [], "interactions": [], "synthesized_glycans": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667055.2", "ac": "NP_667055.2", "name": "olfactory receptor 1107", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "olfactory receptor activity", "id": "GO:0004984" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "odorant binding", "id": "GO:0005549" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "G protein-coupled receptor activity", "id": "GO:0004930" } ], "total": 3, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "id": "A2AVB8", "database": "UniProtKB" } ], "name": "sensory perception of smell", "id": "GO:0007608" } ], "total": 2, "name": "Biological Process" } ] }, "gene_names": [ { "type": "recommended", "resource": "uniprotkb", "name": "Olfr1107" }, { "type": "synonym", "resource": "refseq", "name": "MOR172-2" }, { "type": "synonym", "resource": "refseq", "name": "Olfr1107" } ], "crossref": [ { "url": "http://www.orthodb.org/?query=996660at2759", "id": "996660at2759", "database": "OrthoDB" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/258841", "id": "258841", "database": "GeneID" }, { "url": "http://www.informatics.jax.org/marker/MGI:3030941", "id": "3030941", "database": "MGI" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "id": "IPR000725", "database": "InterPro" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000075163", "id": "ENSMUSG00000075163", "database": "Bgee" }, { "url": "http://pfam.xfam.org/family/PF13853", "id": "PF13853", "database": "Pfam" }, { "url": "https://omabrowser.org/oma/group/AGNWGMI/", "id": "AGNWGMI", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "id": "IPR000276", "database": "InterPro" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667055.2", "id": "NP_667055.2", "database": "RefSeq" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258841", "id": "mmu:258841", "database": "KEGG Pathway" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "id": "IPR017452", "database": "InterPro" } ], "expression_disease": [], "glycosylation": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 35475.0, "chemical_mass": 35475.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AVB8", "name": "Olfr1107", "locus": { "end_pos": 87068671, "start_pos": 87075817, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000075163", "id": "ENSMUSG00000075163", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "type": "recommended", "resource": "uniprotkb", "name": "Olfactory receptor" }, { "type": "synonym", "resource": "refseq", "name": "olfactory receptor 1107" }, { "type": "synonym", "resource": "refseq", "name": "olfactory receptor MOR172-2; GA_x6K02T2Q125-48565383-48564445" } ] }