{ "uniprot_canonical_ac": "A2A799-1", "sequence": { "header": "tr|A2A799-1|A2A799_MOUSE Isoform 1 of Zinc finger protein 979 OS=Mus musculus OX=10090 GN=Zfp979 PE=4 SV=1 CANONICAL=A2A799-1", "length": 407, "sequence": "MFAPHQESGRRTTKRMSASLENTAQCLLTFKDVFLDFSSEEWECLNFAQRTLYMDVMLENYNNLLFVENHCICGNYEKEKVLEQDTQHIFNEHGHIQEKSFKCNESNNIIHESSQSTPHKTNHRDATLQSSNLKRHKTRTTKEVCTYKDCVNRLKVSSTISLNQGTHIEKKEHNRNKNLDEVLVSKHKPIVRQNNSEMNTYTCGEFDKCFTQSDNLQSQQRIYPLKKSYKYSESDKCFTQKFYLGIHQKIHTGEKFYKCNESDKCFKHKFNLSMHQRIHTGEKTYKCIECNKCFMQQSLLSNHERIHTGKKPYKCSECDKCFTHQVSLSIHQRIHSEKKPSKYSECEKCFTHKFNLRTHQTIHTGEKPYKCSECDKCFTHQVSLRIHQRTHSGEKPYKCTECYKCFA" }, "uniprot_id": "A2A799_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A799", "id": "A2A799", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/24803651", "type": "PUBMED", "id": "24803651" } ], "title": "Identification of Ssm1b, a novel modifier of DNA methylation, and its expression during mouse embryogenesis.", "journal": "Development (Cambridge, England)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ], "authors": "Ratnam S, Engler P, Bozek G, Mao L, Podlutsky A, Austad S, Martin T, Storb U", "date": "2014" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20412781", "type": "PUBMED", "id": "20412781" } ], "title": "Resolution of cell fate decisions revealed by single-cell gene expression analysis from zygote to blastocyst.", "journal": "Developmental cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ], "authors": "Guo G, Huss M, Tong GQ, Wang C, Li Sun L, Clarke ND, Robson P", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28464323", "type": "PUBMED", "id": "28464323" } ], "title": "Ssm1b expression and function in germ cells of adult mice and in early embryos.", "journal": "Molecular reproduction and development", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ], "authors": "Ratnam S, Bozek G, Martin T, Gallagher SJ, Payne CJ, Storb U", "date": "2017" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26142281", "type": "PUBMED", "id": "26142281" } ], "title": "Venus trap in the mouse embryo reveals distinct molecular dynamics underlying specification of first embryonic lineages.", "journal": "EMBO reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ], "authors": "Dietrich JE, Panavaite L, Gunther S, Wennekamp S, Groner AC, Pigge A, Salvenmoser S, Trono D, Hufnagel L, Hiiragi T", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17015433", "type": "PUBMED", "id": "17015433" } ], "title": "Cracking the egg: molecular dynamics and evolutionary aspects of the transition from the fully grown oocyte to embryo.", "journal": "Genes & development", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ], "authors": "Evsikov AV, Graber JH, Brockman JM, Hampl A, Holbrook AE, Singh P, Eppig JJ, Solter D, Knowles BB", "date": "2006" } ], "uniprot_ac": "A2A799", "site_annotation": [ { "end_pos": 262, "annotation": "n_glycosylation_sequon", "start_pos": 260 }, { "end_pos": 106, "annotation": "n_glycosylation_sequon", "start_pos": 104 }, { "end_pos": 196, "annotation": "n_glycosylation_sequon", "start_pos": 194 }, { "end_pos": 273, "annotation": "n_glycosylation_sequon", "start_pos": 271 } ], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2A799#A2A799-1", "isoform_ac": "A2A799-1", "locus": { "end_pos": 147613030, "start_pos": 147618491, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000105720", "id": "ENSMUST00000105720", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000101345", "id": "ENSMUSP00000101345", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A2A799-1|A2A799_MOUSE Isoform 1 of Zinc finger protein 979 OS=Mus musculus OX=10090 GN=Zfp979 PE=4 SV=1 CANONICAL=A2A799-1", "length": 407, "sequence": "MFAPHQESGRRTTKRMSASLENTAQCLLTFKDVFLDFSSEEWECLNFAQRTLYMDVMLENYNNLLFVENHCICGNYEKEKVLEQDTQHIFNEHGHIQEKSFKCNESNNIIHESSQSTPHKTNHRDATLQSSNLKRHKTRTTKEVCTYKDCVNRLKVSSTISLNQGTHIEKKEHNRNKNLDEVLVSKHKPIVRQNNSEMNTYTCGEFDKCFTQSDNLQSQQRIYPLKKSYKYSESDKCFTQKFYLGIHQKIHTGEKFYKCNESDKCFKHKFNLSMHQRIHTGEKTYKCIECNKCFMQQSLLSNHERIHTGKKPYKCSECDKCFTHQVSLSIHQRIHSEKKPSKYSECEKCFTHKFNLRTHQTIHTGEKPYKCSECDKCFTHQVSLRIHQRTHSGEKPYKCTECYKCFA" } }, { "url": "https://www.uniprot.org/uniprot/A2A799#A2A7A0-1", "isoform_ac": "A2A7A0-1", "locus": { "end_pos": 147613912, "start_pos": 147618491, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000133006", "id": "ENSMUST00000133006", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000114677", "id": "ENSMUSP00000114677", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A2A7A0-1|A2A799_MOUSE Computationally mapped isoform of Zinc finger protein 979 OS=Mus musculus OX=10090 GN=Zfp979 PE=4 SV=1 CANONICAL=A2A799-1", "length": 113, "sequence": "MFAPHQESGRRTTKRMSASLENTAQCLLTFKDVFLDFSSEEWECLNFAQRTLYMDVMLENYNNLLFVENHCICGNYEKEKVLEQDTQHIFNEHGHIQEKSFKCNESNNIIHES" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:112422", "resource": "KEGG Pathway", "id": "mmu:112422", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "annotation": "This work demonstrates that HRD methylation by Ssm1b is more temporally restricted during spermatogenesis compared to oogenesis, and is altered when embryonic stem cells are cultured from C3H/HeJ inner cell mass cells.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "annotation": "Cloning and expression analysis of Ssm1b protein (2610305D13Rik) during mouse embryogenesis.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" } ] } ], "orthologs": [], "interactions": [], "synthesized_glycans": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "ac": "NP_659544.2", "name": "uncharacterized protein LOC112422", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A799", "id": "A2A799", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A799", "id": "A2A799", "database": "UniProtKB" } ], "name": "nucleic acid binding", "id": "GO:0003676" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A799", "id": "A2A799", "database": "UniProtKB" } ], "name": "regulation of transcription, DNA-templated", "id": "GO:0006355" } ], "total": 1, "name": "Biological Process" } ] }, "gene_names": [ { "type": "synonym", "resource": "refseq", "name": "Zfp979" }, { "type": "synonym", "resource": "refseq", "name": "2610305D13Rik; Ssm1b" }, { "type": "recommended", "resource": "uniprotkb", "name": "Zfp979" } ], "crossref": [ { "url": "http://www.informatics.jax.org/marker/MGI:2148252", "id": "2148252", "database": "MGI" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", "id": "IPR036051", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", "id": "IPR001909", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF00096", "id": "PF00096", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF01352", "id": "PF01352", "database": "Pfam" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:112422", "id": "mmu:112422", "database": "KEGG Pathway" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659544.2", "id": "NP_659544.2", "database": "RefSeq" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "id": "IPR013087", "database": "InterPro" }, { "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07765", "id": "cd07765", "database": "CDD" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/112422", "id": "112422", "database": "GeneID" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000066000", "id": "ENSMUSG00000066000", "database": "Bgee" }, { "url": "http://www.orthodb.org/?query=1318335at2759", "id": "1318335at2759", "database": "OrthoDB" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "id": "IPR036236", "database": "InterPro" } ], "expression_disease": [], "glycosylation": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 48135.0, "chemical_mass": 48135.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2A799", "name": "Zfp979", "locus": { "end_pos": 147611937, "start_pos": 147642513, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000066000", "id": "ENSMUSG00000066000", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "type": "synonym", "resource": "refseq", "name": "uncharacterized protein LOC112422" }, { "type": "synonym", "resource": "uniprotkb", "name": "Zinc finger protein 979" } ] }