{ "uniprot_canonical_ac": "A2AMM0-1", "sequence": { "length": 362, "sequence": "MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS" }, "uniprot_id": "CAVN4_MOUSE", "enzyme_annotation": [], "alternativenames": [ { "full": "Muscle-related coiled-coil protein", "short": "" }, { "full": "Muscle-restricted coiled-coil protein", "short": "" } ], "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "recommendedname": { "full": "Caveolae-associated protein 4" }, "publication": [ { "title": "The coiled-coil domain of MURC/cavin-4 is involved in membrane trafficking of caveolin-3 in cardiomyocytes.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/26497963", "journal": "Am. J. Physiol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0/publications", "id": "A2AMM0", "database": "UniProtKB" } ], "authors": "Taniguchi T., Hamaoka T., Maruyama N., Matoba S., Miyagawa K., Naito D., Nakanishi N., Ogata T., Ueyama T., Nishi M., Kasahara T.", "date": "2015", "pmid": "26497963" }, { "title": "MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by alpha1-adrenergic receptors.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/24567387", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0/publications", "id": "A2AMM0", "database": "UniProtKB" } ], "authors": "Yamada H., Taniguchi T., Hamaoka T., Hayashi Y.K., Ikeda K., Maruyama N., Matoba S., Miyagawa K., Naito D., Nakanishi N., Ogata T., Oh H., Ueyama T.", "date": "2014", "pmid": "24567387" }, { "title": "MURC/Cavin-4 and cavin family members form tissue-specific caveolar complexes.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19546242", "journal": "J. Cell Biol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0/publications", "id": "A2AMM0", "database": "UniProtKB" } ], "authors": "Gygi S.P., Liu L., North K.N., Parton R.G., Hill M.M., Abankwa D., Bastiani M., Hancock J.F., Luetterforst R., Nixon S.J., Pilch P.F., Jedrychowski M.P., Breen M.R., Fernandez-Rojo M., Lo H.P., Vinten J., Walser P.J.", "date": "2009", "pmid": "19546242" }, { "title": "MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18332105", "journal": "Mol. Cell. Biol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0/publications", "id": "A2AMM0", "database": "UniProtKB" } ], "authors": "Takahashi T., Ogata T., Oh H., Ueyama T., Harada K., Kawashima T., Isodono K., Matsubara H., Shioi T., Tagawa M., Takehara N.", "date": "2008", "pmid": "18332105" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0#A2AMM0-1", "isoform_ac": "A2AMM0-1", "locus": { "end_pos": 48663622, "start_pos": 48672642, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000030033", "id": "ENSMUST00000030033", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000030033", "id": "ENSMUSP00000030033", "database": "Ensembl Peptide" } ] }, "sequence": { "length": 362, "sequence": "MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:68016", "resource": "KEGG Pathway", "id": "mmu:68016", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0#function", "annotation": "Modulates the morphology of formed caveolae in cardiomyocytes, but is not required for caveolar formation. Facilitates the recruitment of MAPK1/3 to caveolae within cardiomyocytes and regulates alpha-1 adrenergic receptor-induced hypertrophic responses in cardiomyocytes through MAPK1/3 activation (PubMed:24567387). Contributes to proper membrane localization and stabilization of caveolin-3 (CAV3) in cardiomyocytes (PubMed:26497963). Induces RHOA activation and activates NPPA transcription and myofibrillar organization through the Rho/ROCK signaling pathway (PubMed:18332105).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0#function", "id": "A2AMM0", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "annotation": "The MURC/Cavin-4 in vascular smooth muscle cells modulates abdominal aortic aneurysm (AAA) progression at the early stage via the activation of JNK and MMP-9. MURC/Cavin-4 is a potential therapeutic target against AAA progression.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "id": "NP_080785.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "annotation": "MURC binds to Cav1 and inhibits the association of Cav1 with the active form of Galpha13, resulting in the facilitated association of the active form of Galpha13 with p115RhoGEF. These results reveal that MURC has a function in the development of pulmonary hypertension through modulating Rho/ROCK signaling. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "id": "NP_080785.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "annotation": "MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by alpha1-adrenergic receptors.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "id": "NP_080785.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "annotation": "Data show that MURC/Cavin-4 forms a multiprotein complex that associates with caveolae, and identify Cavin-4 as a novel muscle disease candidate caveolar protein.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "id": "NP_080785.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "annotation": "Findings suggest that MURC is involved in the skeletal myogenesis that results from modulation of myogenin expression and ERK activation; MURC may play pivotal roles in the molecular mechanisms of skeletal myogenic differentiation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "id": "NP_080785.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "annotation": "MURC modulates RhoA signaling, and MURC plays an important role in the development of cardiac dysfunction and conduction disturbance with increased vulnerability to atrial arrhythmias.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "id": "NP_080785.2", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "B1PRL5-1", "protein_name": "Caveolae-associated protein 4", "sequence": { "length": 362, "sequence": "MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AMM0/", "id": "A2AMM0", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/12224", "id": "12224", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q5BKX8-1", "protein_name": "Caveolae-associated protein 4", "sequence": { "length": 364, "sequence": "MEHNGSASNADKIHQNRLSSVTEDEDQDAALTIVTVLDKVASIVDSVQASQKRIEERHREMENAIKSVQIDLLKLSQSHSNTGHIINKLFEKTRKVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVEESRSARLRKSGKEHIDNIKKAFSKENMQKTRQNLDKKVNRIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISNAAPSKEAFKMRSLRKGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLLDLKHSS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AMM0/", "id": "A2AMM0", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/12224", "id": "12224", "database": "MGI" } ], "organism": "Homo sapiens", "tax_id": 9606 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080785.2", "ac": "NP_080785.2", "name": "caveolae-associated protein 4", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "GTPase activator activity", "id": "GO:0005096" } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005901", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "caveola", "id": "GO:0005901" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "sarcolemma", "id": "GO:0042383" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030018", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "Z disc", "id": "GO:0030018" } ], "total": 6, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007266", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "Rho protein signal transduction", "id": "GO:0007266" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007517", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "muscle organ development", "id": "GO:0007517" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035023", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "regulation of Rho protein signal transduction", "id": "GO:0035023" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055003", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "cardiac myofibril assembly", "id": "GO:0055003" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AMM0", "id": "A2AMM0", "database": "UniProtKB" } ], "name": "regulation of gene expression", "id": "GO:0010468" } ], "total": 6, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 6, "annotation": "n_glycosylation_sequon", "start_pos": 4 } ], "crossref": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:68016", "id": "mmu:68016", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028348", "id": "ENSMUSG00000028348", "database": "Bgee" }, { "url": "http://www.informatics.jax.org/marker/MGI:1915266", "id": "1915266", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/RPVYPAH/", "id": "RPVYPAH", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR033299", "id": "IPR033299", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026752", "id": "IPR026752", "database": "InterPro" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/68016", "id": "68016", "database": "GeneID" }, { "url": "http://pfam.xfam.org/family/PF15237", "id": "PF15237", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15240:SF4", "id": "PTHR15240:SF4", "database": "PANTHER" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15240", "id": "PTHR15240", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2AMM0", "id": "PR_A2AMM0", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A2AMM0*", "id": "A2AMM0", "database": "IntAct" } ], "expression_disease": [], "uniprot_ac": "A2AMM0", "disease": [], "mass": { "monoisotopic_mass": 41008.0, "chemical_mass": 41008.0 }, "expression_tissue": [], "gene": [ { "url": "http://www.informatics.jax.org/marker/MGI:1915266", "name": "Cavin4", "locus": { "end_pos": 48673502, "start_pos": 48663514, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000028348", "id": "ENSMUSG00000028348", "database": "Ensembl Gene" } ] } } ] }