{ "uniprot_canonical_ac": "A4D2G3-1", "sequence": { "length": 310, "sequence": "MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYFFLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYDRYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEIMAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSICSSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRMLEKKRTS" }, "uniprot_id": "O2A25_HUMAN", "enzyme_annotation": [], "alternativenames": [ { "full": "Olfactory receptor 2A27", "short": "" } ], "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3", "id": "A4D2G3", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Olfactory receptor 2A25" }, "publication": [ { "title": "Gene variants associated with ischemic stroke: the cardiovascular health study.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19023099", "journal": "Stroke", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", "id": "NP_001004488.1", "database": "RefSeq" } ], "authors": "Luke MM, O'Meara ES, Rowland CM, Shiffman D, Bare LA, Arellano AR, Longstreth WT Jr, Lumley T, Rice K, Tracy RP, Devlin JJ, Psaty BM", "date": "2009", "pmid": "19023099" }, { "title": "Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17975119", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", "id": "NP_001004488.1", "database": "RefSeq" } ], "authors": "Shiffman D, O'Meara ES, Bare LA, Rowland CM, Louie JZ, Arellano AR, Lumley T, Rice K, Iakoubova O, Luke MM, Young BA, Malloy MJ, Kane JP, Ellis SG, Tracy RP, Devlin JJ, Psaty BM", "date": "2008", "pmid": "17975119" } ], "glycosylation": [ { "residue": "Asn", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3#ptm_processing", "id": "A4D2G3-1", "database": "UniProtKB" } ], "relation": "attached", "position": 4, "glytoucan_ac": "GlcNAc...", "type": "N-linked" } ], "mutation": [ { "start_pos": 3, "subjects_positive": "5", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0149", "annotation": "Somatic mutation in Skin cancer (DOID:4159) with frequency of 5/335 (0.0149)", "sequence_org": "G", "disease": { "doid": "4159", "url": "http://disease-ontology.org/term/DOID:4159", "icd10": "", "name": "Skin cancer" }, "sequence_mut": "E", "subjects_tested": "335", "end_pos": 3, "type": "Point mutation" }, { "start_pos": 28, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0263", "annotation": "Somatic mutation in Lung cancer (DOID:1324) with frequency of 1/38 (0.0263)", "sequence_org": "G", "disease": { "doid": "1324", "url": "http://disease-ontology.org/term/DOID:1324", "icd10": "", "name": "Lung cancer" }, "sequence_mut": "E", "subjects_tested": "38", "end_pos": 28, "type": "Point mutation" }, { "start_pos": 71, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0152", "annotation": "Somatic mutation in Lung cancer (DOID:1324) with frequency of 1/66 (0.0152)", "sequence_org": "A", "disease": { "doid": "1324", "url": "http://disease-ontology.org/term/DOID:1324", "icd10": "", "name": "Lung cancer" }, "sequence_mut": "T", "subjects_tested": "66", "end_pos": 71, "type": "Point mutation" }, { "start_pos": 82, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0200", "annotation": "Somatic mutation in Breast cancer (DOID:1612) with frequency of 1/50 (0.0200)", "sequence_org": "V", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "A", "subjects_tested": "50", "end_pos": 82, "type": "Point mutation" }, { "start_pos": 209, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0200", "annotation": "Somatic mutation in Breast cancer (DOID:1612) with frequency of 1/50 (0.0200)", "sequence_org": "A", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "P", "subjects_tested": "50", "end_pos": 209, "type": "Point mutation" }, { "start_pos": 226, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0106", "annotation": "Somatic mutation in Colorectal cancer (DOID:9256) with frequency of 1/94 (0.0106)", "sequence_org": "K", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "N", "subjects_tested": "94", "end_pos": 226, "type": "Point mutation" }, { "start_pos": 250, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0108", "annotation": "Somatic mutation in Ovarian cancer (DOID:2394) with frequency of 1/93 (0.0108)", "sequence_org": "F", "disease": { "doid": "2394", "url": "http://disease-ontology.org/term/DOID:2394", "icd10": "", "name": "Ovarian cancer" }, "sequence_mut": "L", "subjects_tested": "93", "end_pos": 250, "type": "Point mutation" }, { "start_pos": 277, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0139", "annotation": "Somatic mutation in Breast cancer (DOID:1612) with frequency of 1/72 (0.0139)", "sequence_org": "H", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "Y", "subjects_tested": "72", "end_pos": 277, "type": "Point mutation" }, { "start_pos": 278, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0108", "annotation": "Somatic mutation in Ovarian cancer (DOID:2394) with frequency of 1/93 (0.0108)", "sequence_org": "S", "disease": { "doid": "2394", "url": "http://disease-ontology.org/term/DOID:2394", "icd10": "", "name": "Ovarian cancer" }, "sequence_mut": "R", "subjects_tested": "93", "end_pos": 278, "type": "Point mutation" }, { "start_pos": 105, "subjects_positive": "3", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", "id": "A4D2G3", "database": "BioMuta" } ], "frequency": "0.0200", "annotation": "Somatic mutation in Hematologic cancer (DOID:2531) with frequency of 3/150 (0.0200)", "sequence_org": "S", "disease": { "doid": "2531", "url": "http://disease-ontology.org/term/DOID:2531", "icd10": "", "name": "Hematologic cancer" }, "sequence_mut": "C", "subjects_tested": "150", "end_pos": 105, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3#A4D2G3-1", "isoform_ac": "A4D2G3-1", "locus": { "end_pos": 144074220, "start_pos": 144075149, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000641663", "id": "ENST00000641663", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000493343", "id": "ENSP00000493343", "database": "Ensembl Peptide" } ] }, "sequence": { "length": 310, "sequence": "MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYFFLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYDRYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEIMAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSICSSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRMLEKKRTS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:392138", "resource": "KEGG Pathway", "id": "hsa:392138", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", "resource": "Reactome", "id": "R-HSA-381753", "name": "Olfactory Signaling Pathway" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3#function", "annotation": "Odorant receptor.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3#function", "id": "A4D2G3", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", "id": "NP_001004488.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q8VGP6-1", "protein_name": "Olfactory receptor", "sequence": { "length": 310, "sequence": "MGGNQTLITQFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTILGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLMDPAKPISFAGCMTQTFLFLTFAHTECLLLVVMSYDRYVAICHPLRYTAIMSWRVCVILVLTSWILGVLLALVHLVLLLPLPFCGSQKVNHFFCEIIAVLKLACSDTRINELMVLAGAVSVLVGPFSSIVVSYAHILCAILKIKSQQGRQKAFSTCSSHLCVVGLFYGTAIVMYIGPQHGKSNEQKKYLLLFHSLFNPMLNPLIYSLRNKEVKSALKRTLLKEDTS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/17457", "id": "17457", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "D4AEF2-1", "protein_name": "Olfactory receptor", "sequence": { "length": 313, "sequence": "MGGNQTLITQFILLGFPLSPRMQMLLFVLFSLFYAFTLLGNGTILGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLMDPAKPISFAGCMTQTFLFLTFAHTECLLLVVMSYDRYVAICHPLRYTVIMSWRVCVIFVLTSWILGVLLALVHLVLLLPLPFCGSQKVNHFFCEIIAVLKLACSDTRINEVMVLAGAVSVLVGPFSSIVVSYTHILCAILKIKSQQGRQKAFSTCSSHLCVVGLFYGTAIVMYIGPQHGKSNEQKKYLLLFHSLFNPMLNPLIYSLRNKDVKSALKRMLIKEDTSSGC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/17457", "id": "17457", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", "ac": "NP_001004488.1", "name": "olfactory receptor 2A25", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3", "id": "A4D2G3", "database": "UniProtKB" } ], "name": "G protein-coupled receptor activity", "id": "GO:0004930" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3", "id": "A4D2G3", "database": "UniProtKB" } ], "name": "olfactory receptor activity", "id": "GO:0004984" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3", "id": "A4D2G3", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3", "id": "A4D2G3", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D2G3", "id": "A4D2G3", "database": "UniProtKB" } ], "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186" } ], "total": 1, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 6, "annotation": "n_glycosylation_sequon", "start_pos": 4 }, { "end_pos": 43, "annotation": "n_glycosylation_sequon", "start_pos": 41 } ], "crossref": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:392138", "id": "hsa:392138", "database": "KEGG Pathway" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", "id": "R-HSA-381753", "database": "Reactome" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=19562", "id": "19562", "database": "HGNC" }, { "url": "https://omabrowser.org/oma/group/CAILKIQ/", "id": "CAILKIQ", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "id": "IPR000276", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "id": "IPR017452", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "id": "IPR000725", "database": "InterPro" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR2A25", "id": "OR2A25", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/392138", "id": "392138", "database": "GeneID" }, { "url": "http://pfam.xfam.org/family/PF13853", "id": "PF13853", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A4D2G3", "id": "PR_A4D2G3", "database": "PRO" }, { "url": "https://www.nextprot.org/entry/NX_A4D2G3", "id": "NX_A4D2G3", "database": "neXtProt" } ], "expression_disease": [], "uniprot_ac": "A4D2G3", "disease": [], "mass": { "monoisotopic_mass": 34606.0, "chemical_mass": 34606.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=19562", "name": "OR2A25", "locus": { "end_pos": 144075870, "start_pos": 144069811, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000221933", "id": "ENSG00000221933", "database": "Ensembl Gene" } ] } } ] }