{
    "uniprot_canonical_ac": "A3KGA4-1", 
    "sequence": {
        "header": "sp|A3KGA4-1|TCAL7_MOUSE Isoform 1 of Transcription elongation factor A protein-like 7  OS=Mus musculus OX=10090 GN=Tceal7 PE=3 SV=1 CANONICAL=A3KGA4-1", 
        "length": 98, 
        "sequence": "MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQRLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSNRTHSRDHPF"
    }, 
    "uniprot_id": "TCAL7_MOUSE", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "transcription elongation factor A protein-like 7", 
                "TCEA-like protein 7; transcription elongation factor S-II protein-like 7"
            ], 
            "uniprotkb": [
                "Transcription elongation factor A protein-like 7", 
                "TCEA-like protein 7", 
                "Transcription elongation factor S-II protein-like 7"
            ]
        }, 
        "gene": {
            "refseq": [
                "Tceal7", 
                "1110018P05Rik"
            ], 
            "uniprotkb": [
                "Tceal7", 
                "1110018P05Rik"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A3KGA4", 
                    "id": "A3KGA4", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "recommendedname": {
        "full": "Transcription elongation factor A protein-like 7; TCEA-like protein 7; Transcription elongation factor S-II protein-like 7.", 
        "short": "TCEA-like protein 7"
    }, 
    "publication": [
        {
            "title": "Myogenic regulatory factors transactivate the Tceal7 gene and modulate muscle differentiation.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/20307260", 
            "journal": "The Biochemical journal", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
                    "id": "NP_001120641.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Shi X, Garry DJ", 
            "date": "2010", 
            "pmid": "20307260"
        }, 
        {
            "title": "Epigenetic silencing of TCEAL7 (Bex4) in ovarian cancer.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/15870691", 
            "journal": "Oncogene", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
                    "id": "NP_001120641.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Chien J, Staub J, Avula R, Zhang H, Liu W, Hartmann LC, Kaufmann SH, Smith DI, Shridhar V", 
            "date": "2005", 
            "pmid": "15870691"
        }, 
        {
            "title": "Targeting a complex transcriptome: the construction of the mouse full-length cDNA encyclopedia.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/12819125", 
            "journal": "Genome research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
                    "id": "NP_001120641.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Carninci P, Waki K, Shiraki T, Konno H, Shibata K, Itoh M, Aizawa K, Arakawa T, Ishii Y, Sasaki D, Bono H, Kondo S, Sugahara Y, Saito R, Osato N, Fukuda S, Sato K, Watahiki A, Hirozane-Kishikawa T, Nakamura M, Shibata Y, Yasunishi A, Kikuchi N, Yoshiki A, Kusakabe M, Gustincich S, Beisel K, Pavan W, Aidinis V, Nakagawara A, Held WA, Iwata H, Kono T, Nakauchi H, Lyons P, Wells C, Hume DA, Fagiolini M, Hensch TK, Brinkmeier M, Camper S, Hirota J, Mombaerts P, Muramatsu M, Okazaki Y, Kawai J, Hayashizaki Y", 
            "date": "2003", 
            "pmid": "12819125"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A3KGA4#A3KGA4-1", 
            "isoform_ac": "A3KGA4-1", 
            "locus": {
                "end_pos": 136225266, 
                "start_pos": 136225559, 
                "chromosome": "X", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000113116", 
                        "id": "ENSMUST00000113116", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000108741", 
                        "id": "ENSMUSP00000108741", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A3KGA4-1|TCAL7_MOUSE Isoform 1 of Transcription elongation factor A protein-like 7  OS=Mus musculus OX=10090 GN=Tceal7 PE=3 SV=1 CANONICAL=A3KGA4-1", 
                "length": 98, 
                "sequence": "MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQRLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSNRTHSRDHPF"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A3KGA4#A3KGA3-1", 
            "isoform_ac": "A3KGA3-1", 
            "locus": {
                "end_pos": 136225266, 
                "start_pos": 136225385, 
                "chromosome": "X", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000126811", 
                        "id": "ENSMUST00000126811", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000122260", 
                        "id": "ENSMUSP00000122260", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A3KGA3-1|TCAL7_MOUSE Computationally mapped isoform of Transcription elongation factor A protein-like 7  OS=Mus musculus OX=10090 GN=Tceal7 PE=3 SV=1 CANONICAL=A3KGA4-1", 
                "length": 40, 
                "sequence": "MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQR"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:100040972", 
            "resource": "KEGG Pathway", 
            "id": "mmu:100040972", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A3KGA4#function", 
            "annotation": "Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines (By similarity).", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A3KGA4#function", 
                    "id": "A3KGA4", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
            "annotation": "The studies support the hypothesis that MRFs transactivate Tceal7 gene expression and promote muscle differentiation during muscle development and regeneration. Publication Status: Online-Only", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
                    "id": "NP_001120641.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
            "annotation": "These data implicate human TCEAL7 as a cell death regulatory protein that is frequently inactivated in ovarian cancers, and suggest that it may function as a tumor suppressor.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
                    "id": "NP_001120641.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "D3ZT37-1", 
            "protein_name": "Transcription elongation factor A protein-like 7; TCEA-like protein 7; Transcription elongation factor S-II protein-like 7.", 
            "sequence": {
                "length": 98, 
                "sequence": "MQRSCNEKEGKPKCSEPKREEEHPYGAFEGQRLEGNFRQRLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSNRTHSRDRPF"
            }, 
            "evidence": [
                {
                    "url": "https://omabrowser.org/oma/group/307433/", 
                    "id": "307433", 
                    "database": "OMA"
                }, 
                {
                    "url": "http://www.informatics.jax.org/homology/87220", 
                    "id": "87220", 
                    "database": "MGI"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q9BRU2-1", 
            "protein_name": "Transcription elongation factor A protein-like 7; TCEA-like protein 7; Transcription elongation factor S-II protein-like 7.", 
            "sequence": {
                "length": 100, 
                "sequence": "MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/87220", 
                    "id": "87220", 
                    "database": "MGI"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
        "ac": "NP_001120641.1", 
        "name": "transcription elongation factor A protein-like 7; TCEA-like protein 7; transcription elongation factor S-II protein-like 7.", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050699", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A3KGA4", 
                                "id": "A3KGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "WW domain binding", 
                        "id": "GO:0050699"
                    }
                ], 
                "total": 1, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A3KGA4", 
                                "id": "A3KGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleus", 
                        "id": "GO:0005634"
                    }
                ], 
                "total": 1, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A3KGA4", 
                                "id": "A3KGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of transcription, DNA-templated", 
                        "id": "GO:0045892"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032088", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A3KGA4", 
                                "id": "A3KGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of NF-kappaB transcription factor activity", 
                        "id": "GO:0032088"
                    }
                ], 
                "total": 2, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 91, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 89
        }
    ], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120641.1", 
            "id": "NP_001120641.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:100040972", 
            "id": "mmu:100040972", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000079428", 
            "id": "ENSMUSG00000079428", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/DYRHFKG/", 
            "id": "DYRHFKG", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR021156", 
            "id": "IPR021156", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF04538", 
            "id": "PF04538", 
            "database": "Pfam"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A3KGA4", 
            "id": "PR_A3KGA4", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/100040972", 
            "id": "100040972", 
            "database": "GeneID"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:1915746", 
            "id": "1915746", 
            "database": "MGI"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A3KGA4", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 11697.0, 
        "chemical_mass": 11697.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A3KGA4", 
            "name": "Tceal7; 1110018P05Rik.", 
            "locus": {
                "end_pos": 136226100, 
                "start_pos": 136214779, 
                "chromosome": "X", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000079428", 
                        "id": "ENSMUSG00000079428", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}