{ "uniprot_canonical_ac": "A1BPI0-1", "sequence": { "header": "sp|A1BPI0-1|OAZ3_RAT Isoform 1 of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1", "length": 243, "sequence": "MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ" }, "uniprot_id": "OAZ3_RAT", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "ornithine decarboxylase antizyme 3", "antizyme 3" ], "uniprotkb": [ "Ornithine decarboxylase antizyme 3", "AZ3", "ODC-Az 3" ] }, "gene": { "refseq": [ "Oaz3", "Az3", "Oaz-t", "ODC-Az 3" ], "uniprotkb": [ "Oaz3", "Az3", "Oaz-t", "ODC-Az 3" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "recommendedname": { "full": "Ornithine decarboxylase antizyme 3; AZ3; ODC-Az 3.", "short": "AZ3" }, "publication": [ { "title": "Structural and degradative aspects of ornithine decarboxylase antizyme inhibitor 2.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/24967154", "journal": "FEBS open bio", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Ramos-Molina B, Lambertos A, Lopez-Contreras AJ, Kasprzak JM, Czerwoniec A, Bujnicki JM, Cremades A, Penafiel R", "date": "2014", "pmid": "24967154" }, { "title": "Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22516433", "journal": "Journal of proteomics", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Bastos-Amador P, Royo F, Gonzalez E, Conde-Vancells J, Palomo-Diez L, Borras FE, Falcon-Perez JM", "date": "2012", "pmid": "22516433" }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22673903", "journal": "Nat. Commun.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "authors": "Olsen J.V., Lage K., Secher A., Dmytriyev A., Lundby A., Lundby C., Nordsborg N.B.", "date": "2012", "pmid": "22673903" }, { "title": "Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21712390", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Ruan Y., Ou Y., Cheng M., van der Hoorn F.A., Oko R.", "date": "2011", "pmid": "21712390" }, { "title": "Proteomic characterization of the human sperm nucleus.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21630459", "journal": "Proteomics", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "de Mateo S, Castillo J, Estanyol JM, Ballesca JL, Oliva R", "date": "2011", "pmid": "21630459" }, { "title": "Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17900240", "journal": "The Biochemical journal", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Kanerva K, Makitie LT, Pelander A, Heiskala M, Andersson LC", "date": "2008", "pmid": "17900240" }, { "title": "Mammalian transcription in support of hybrid mRNA and protein synthesis in testis and lung.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17040916", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Cheng M., van der Hoorn F.A., Oko R., Dong K., Fitzgerald C., Lawson V., Sikora C.", "date": "2006", "pmid": "17040916" }, { "title": "Mouse ornithine decarboxylase-like gene encodes an antizyme inhibitor devoid of ornithine and arginine decarboxylating activity.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/16916800", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Lopez-Contreras AJ, Lopez-Garcia C, Jimenez-Cervantes C, Cremades A, Penafiel R", "date": "2006", "pmid": "16916800" }, { "title": "Yeast two-hybrid screens imply that GGNBP1, GGNBP2 and OAZ3 are potential interaction partners of testicular germ cell-specific protein GGN1.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/15642376", "journal": "FEBS letters", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Zhang J, Wang Y, Zhou Y, Cao Z, Huang P, Lu B", "date": "2005", "pmid": "15642376" }, { "title": "Discovery of a spermatogenesis stage-specific ornithine decarboxylase antizyme: antizyme 3.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/10781085", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ], "authors": "Ivanov IP, Rohrwasser A, Terreros DA, Gesteland RF, Atkins JF", "date": "2000", "pmid": "10781085" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0#A1BPI0-1", "isoform_ac": "A1BPI0-1", "locus": { "end_pos": 0, "start_pos": 0, "chromosome": "N/A", "evidence": [] }, "sequence": { "header": "sp|A1BPI0-1|OAZ3_RAT Isoform 1 of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1", "length": 243, "sequence": "MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ" } }, { "url": "https://www.uniprot.org/uniprot/A1BPI0#A0A096P6M0-1", "isoform_ac": "A0A096P6M0-1", "locus": { "end_pos": 195676048, "start_pos": 195678848, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000028303", "id": "ENSRNOT00000028303", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000028303", "id": "ENSRNOP00000028303", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A096P6M0-1|OAZ3_RAT Computationally mapped isoform of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=2 CANONICAL=A1BPI0-1", "length": 243, "sequence": "LPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ" } }, { "url": "https://www.uniprot.org/uniprot/A1BPI0#A1BPI0-2", "isoform_ac": "A1BPI0-2", "locus": { "end_pos": 0, "start_pos": 0, "chromosome": "N/A", "evidence": [] }, "sequence": { "header": "sp|A1BPI0-2|OAZ3_RAT Isoform 2 of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1", "length": 86, "sequence": "MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCS" } }, { "url": "https://www.uniprot.org/uniprot/A1BPI0#M0RB36-1", "isoform_ac": "M0RB36-1", "locus": { "end_pos": 195678268, "start_pos": 195678848, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000075569", "id": "ENSRNOT00000075569", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000066758", "id": "ENSRNOP00000066758", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|M0RB36-1|OAZ3_RAT Computationally mapped isoform of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1", "length": 105, "sequence": "LPCTRSRPSLYSLSYIKRGNTELPLPILVTIRLLPLLLQIPDHPPGEDAALLLQKHHLQGTGGPDSPAPLLPPVLLPPVLLPPVLESLEGLQVGRSTAQEKDHSQ" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?rno:689588", "resource": "KEGG Pathway", "id": "rno:689588", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-350562", "resource": "Reactome", "id": "R-RNO-350562", "name": "Regulation of ornithine decarboxylase (ODC)" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0#function", "annotation": "Isoform 2: Does not possess antizyme activity. Modulates PPP1CB activity through its interaction with PPP1R16A.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0#function", "id": "A1BPI0", "database": "UniProtKB" } ] }, { "url": "https://www.uniprot.org/uniprot/A1BPI0#function", "annotation": "Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimers. Does not target the ODC monomers for degradation, which allows a protein synthesis-independent restoration of ODC activity. Stabilizes AZIN2 by interfering with its ubiquitination. Involved in the translocation of AZNI2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol. Probably plays a key role in spermatogenesis by regulating the intracellular concentration of polyamines in haploid germ cells (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0#function", "id": "A1BPI0", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "annotation": "Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "annotation": "N-terminal protein sequencing suggests translation initiation from a non-AUG (CUG) start site.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q9R109-1", "protein_name": "Ornithine decarboxylase antizyme 3; AZ3; ODC-Az 3; OAZ-t.", "sequence": { "length": 243, "sequence": "MPCNRSRPSLYSLSYIKRGKTRNYLYPFWSPFAYYLYCYKYRITLREKMLPCCYKSITYKEQEDLTLRPHCCLPCSCLPCSCLQCSESLGGLQVGRSTAQEKDHSQLKELYSAGNLTVLSTDPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQIDRKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGHPGQ" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/9410", "id": "9410", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q9UMX2-1", "protein_name": "Ornithine decarboxylase antizyme 3; AZ3; ODC-Az 3.", "sequence": { "length": 235, "sequence": "MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKEEEDLTLQPRSCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLCDRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/9410", "id": "9410", "database": "MGI" } ], "organism": "Homo sapiens", "tax_id": 9606 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "ac": "NP_001094488.1", "name": "ornithine decarboxylase antizyme 3; antizyme 3.", "summary": "The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 3, the third member of the antizyme family. Like antizymes 1 and 2, antizyme 3 inhibits ODC activity and polyamine uptake; however, it does not stimulate ODC degradation. Also, while antizymes 1 and 2 have broad tissue distribution, expression of antizyme 3 is restricted to haploid germ cells in testis, suggesting a distinct role for this antizyme in spermiogenesis. Antizyme 3 gene knockout studies showed that homozygous mutant male mice were infertile, and indicated the likely role of this antizyme in the formation of a rigid connection between the sperm head and tail during spermatogenesis. This transcript initiates translation from a non-AUG (CUG) codon that is highly conserved among the antizyme 3 orthologs. [provided by RefSeq, Dec 2014]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008073", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "ornithine decarboxylase inhibitor activity", "id": "GO:0008073" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071532", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "ankyrin repeat binding", "id": "GO:0071532" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036126", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "sperm flagellum", "id": "GO:0036126" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043666", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "regulation of phosphoprotein phosphatase activity", "id": "GO:0043666" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "positive regulation of protein catabolic process", "id": "GO:0045732" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0", "database": "UniProtKB" } ], "name": "spermatogenesis", "id": "GO:0007283" } ], "total": 3, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 117, "annotation": "n_glycosylation_sequon", "start_pos": 115 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488.1", "id": "NP_001094488.1", "database": "RefSeq" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-350562", "id": "R-RNO-350562", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?rno:689588", "id": "rno:689588", "database": "KEGG Pathway" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR016181", "id": "IPR016181", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR002993", "id": "IPR002993", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029913", "id": "IPR029913", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR038581", "id": "IPR038581", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF02100", "id": "PF02100", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10279", "id": "PTHR10279", "database": "PANTHER" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10279:SF9", "id": "PTHR10279:SF9", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1BPI0", "id": "PR_A1BPI0", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/689588", "id": "689588", "database": "GeneID" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1599278", "id": "1599278", "database": "RGD" } ], "expression_disease": [], "uniprot_ac": "A1BPI0", "disease": [], "mass": { "monoisotopic_mass": 28185.0, "chemical_mass": 28185.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1BPI0", "name": "Oaz3; Az3; Oaz-t; ODC-Az 3.", "locus": { "end_pos": 195676048, "start_pos": 195678848, "chromosome": "2", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000020863", "id": "ENSRNOG00000020863", "database": "Ensembl Gene" } ] } } ] }