{ "uniprot_canonical_ac": "A0JLT2-1", "sequence": { "header": "sp|A0JLT2-1|MED19_HUMAN Isoform 1 of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2 CANONICAL=A0JLT2-1", "length": 244, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" }, "uniprot_id": "MED19_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "mediator of RNA polymerase II transcription subunit 19 isoform 1", "lung cancer metastasis-related protein 1; mediator of RNA polymerase II transcription subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog; putative mediator subunit MED19AS protein" ], "uniprotkb": [ "Mediator of RNA polymerase II transcription subunit 19", "Mediator complex subunit 19", "Lung cancer metastasis-related protein 1" ] }, "gene": { "refseq": [ "MED19", "DT2P1G7", "LCMR1", "MED19AS" ], "uniprotkb": [ "MED19", "LCMR1", "DT2P1G7", "MED19AS" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Mediator of RNA polymerase II transcription subunit 19; Mediator complex subunit 19; Lung cancer metastasis-related protein 1." }, "publication": [ { "title": "Knockdown of mediator subunit Med19 suppresses bladder cancer cell proliferation and migration by downregulating Wnt/beta-catenin signalling pathway.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/28631286", "journal": "Journal of cellular and molecular medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Yuan H, Yu S, Cui Y, Men C, Yang D, Gao Z, Zhu Z, Wu J", "date": "2017", "pmid": "28631286" }, { "title": "LCMR1 interacts with DEK to suppress apoptosis in lung cancer cells.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/28765911", "journal": "Molecular medicine reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Xu Y, Liang Z, Li C, Yang Z, Chen L", "date": "2017", "pmid": "28765911" }, { "title": "Med19 promotes breast cancer cell proliferation by regulating CBFA2T3/HEB expression.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27572702", "journal": "Breast cancer (Tokyo, Japan)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Zhang X, Fan Y, Liu B, Qi X, Guo Z, Li L", "date": "2017", "pmid": "27572702" }, { "title": "Knockdown of Mediator Complex Subunit 19 Suppresses the Growth and Invasion of Prostate Cancer Cells.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/28125713", "journal": "PloS one", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Yu S, Wang Y, Yuan H, Zhao H, Lv W, Chen J, Wan F, Liu D, Gao Z, Wu J", "date": "2017", "pmid": "28125713" }, { "title": "The FOXD3/miR-214/MED19 axis suppresses tumour growth and metastasis in human colorectal cancer.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27811858", "journal": "British journal of cancer", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "He GY, Hu JL, Zhou L, Zhu XH, Xin SN, Zhang D, Lu GF, Liao WT, Ding YQ, Liang L", "date": "2016", "pmid": "27811858" }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17081983", "journal": "Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "authors": "Blagoev B., Gnad F., Kumar C., Macek B., Mann M., Mortensen P., Olsen J.V.", "date": "2006", "pmid": "17081983" }, { "title": "A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/15175163", "journal": "Mol. Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "authors": "Cai Y., Conaway J.W., Conaway R.C., Florens L., Jin J., Parmely T.J., Sato S., Swanson S.K., Tomomori-Sato C., Washburn M.P., Banks C.A.S., Zybailov B.", "date": "2004", "pmid": "15175163" }, { "title": "A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/14638676", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Tomomori-Sato C, Sato S, Parmely TJ, Banks CA, Sorokina I, Florens L, Zybailov B, Washburn MP, Brower CS, Conaway RC, Conaway JW", "date": "2004", "pmid": "14638676" }, { "title": "Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/12584197", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ], "authors": "Cai Y., Conaway J.W., Conaway R.C., Jin J., Lane W.S., Parmely T.J., Sato S., Sorokina I., Tomomori-Sato C., Banks C.A.S., Brower C.S., Kong S.E.", "date": "2003", "pmid": "12584197" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0JLT2-1", "isoform_ac": "A0JLT2-1", "locus": { "end_pos": 0, "start_pos": 0, "chromosome": "N/A", "evidence": [] }, "sequence": { "header": "sp|A0JLT2-1|MED19_HUMAN Isoform 1 of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2 CANONICAL=A0JLT2-1", "length": 244, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#J3KR33-1", "isoform_ac": "J3KR33-1", "locus": { "end_pos": 57704041, "start_pos": 57712179, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000431606", "id": "ENST00000431606", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000416227", "id": "ENSP00000416227", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|J3KR33-1|MED19_HUMAN Computationally mapped isoform of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=3 CANONICAL=A0JLT2-1", "length": 244, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0JLT2-2", "isoform_ac": "A0JLT2-2", "locus": { "end_pos": 57704625, "start_pos": 57712179, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000337672", "id": "ENST00000337672", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000337340", "id": "ENSP00000337340", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0JLT2-2|MED19_HUMAN Isoform 2 of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2 CANONICAL=A0JLT2-1", "length": 194, "sequence": "MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0A494C0G4-1", "isoform_ac": "A0A494C0G4-1", "locus": { "end_pos": 57704625, "start_pos": 57712230, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000650677", "id": "ENST00000650677", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000498522", "id": "ENSP00000498522", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A494C0G4-1|MED19_HUMAN Computationally mapped isoform of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=1 CANONICAL=A0JLT2-1", "length": 211, "sequence": "MKITNGRHGDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS" } }, { "url": "https://www.uniprot.org/uniprot/A0JLT2#A0A494C0Y4-1", "isoform_ac": "A0A494C0Y4-1", "locus": { "end_pos": 57704041, "start_pos": 57712230, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000650726", "id": "ENST00000650726", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000498791", "id": "ENSP00000498791", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A494C0Y4-1|MED19_HUMAN Computationally mapped isoform of Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=1 CANONICAL=A0JLT2-1", "length": 261, "sequence": "MKITNGRHGDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:219541", "resource": "KEGG Pathway", "id": "hsa:219541", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "id": "R-HSA-1989781", "name": "PPARA activates gene expression" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2#function", "annotation": "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2#function", "id": "A0JLT2", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "The data suggest that Med19 expression correlates with aggressive characteristics of bladder cancer, and Med19 knockdown suppresses the proliferation and migration of cancer cells through down-regulating the Wnt/beta-catenin pathway.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "DEK and LCMR1 were demonstrated to cooperate in the inhibition of apoptosis in lung cancer cells.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "Med19 promotes breast cancer cell proliferation and that this effect is associated with regulating CBFA2T3 and HEB expression.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "We knocked down the Med19 expression in prostate cancer cell lines LNCaP and PC3 by using lentivirus siRNA. Cell proliferation, anchor-independent growth, migration, and invasion were suppressed in Med19 knockdown prostate cancer cells. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "annotation": "FOXD3/miR-214/MED19 axis is important for the regulation of growth, invasion and metastasis of colorectal cancer", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q8C1S0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19; Mediator complex subunit 19.", "sequence": { "length": 244, "sequence": "MENFTALFGAQTDPPPPPSALGFGPGKPPPPPPPPPGGGPGAAPPSTATSAPAGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/14684", "id": "14684", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "D3ZAP1-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19; Mediator complex subunit 19.", "sequence": { "length": 244, "sequence": "MENFTALFGAQTDPPPPPSALGFGPGKPPPPPPPPPGGGPGTAPPSTATSAPVGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/14684", "id": "14684", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "ac": "NP_001304007.1", "name": "mediator of RNA polymerase II transcription subunit 19 isoform 1; lung cancer metastasis-related protein 1; mediator of RNA polymerase II transcription subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog; putative mediator subunit MED19AS protein.", "summary": "The protein encoded by this gene is a subunit of the Mediator complex, which binds to gene-specific regulatory factors and provides support for the basal RNA polymerase II transcription machinery. This gene has been implicated in the growth of several types of cancer, and inhibition of its expression inhibits the growth and spread of these cancers. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008134", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "transcription factor binding", "id": "GO:0008134" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003712", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "transcription coregulator activity", "id": "GO:0003712" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016592", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "mediator complex", "id": "GO:0016592" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "nuclear body", "id": "GO:0016604" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "id": "A0JLT2", "database": "UniProtKB" } ], "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944" } ], "total": 1, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 5, "annotation": "n_glycosylation_sequon", "start_pos": 3 }, { "end_pos": 126, "annotation": "n_glycosylation_sequon", "start_pos": 124 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001304007.1", "id": "NP_001304007.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=29600", "id": "29600", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A0JLT2", "id": "A0JLT2", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A0JLT2", "id": "NX_A0JLT2", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MED19", "id": "MED19", "database": "GeneCards" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "id": "R-HSA-381340", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "id": "R-HSA-1989781", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:219541", "id": "hsa:219541", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000156603", "id": "ENSG00000156603", "database": "Bgee" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR019403", "id": "IPR019403", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF10278", "id": "PF10278", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22536", "id": "PTHR22536", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0JLT2", "id": "PR_A0JLT2", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A0JLT2*", "id": "A0JLT2", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/219541", "id": "219541", "database": "GeneID" } ], "expression_disease": [ { "trend": "Down", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0JLT2", "id": "A0JLT2", "database": "BioXpress" } ] } ], "uniprot_ac": "A0JLT2", "disease": [], "mass": { "monoisotopic_mass": 26273.0, "chemical_mass": 26273.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=R-HSA-1989781", "id": "R-HSA-1989781", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0JLT2", "name": "MED19; LCMR1; DT2P1G7; MED19AS.", "locus": { "end_pos": 57703714, "start_pos": 57712323, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000156603", "id": "ENSG00000156603", "database": "Ensembl Gene" } ] } } ] }