{ "uniprot_canonical_ac": "A5LHX3-1", "sequence": { "header": "sp|A5LHX3-1|PSB11_HUMAN Isoform 1 of Proteasome subunit beta type-11 OS=Homo sapiens OX=9606 GN=PSMB11 PE=2 SV=1 CANONICAL=A5LHX3-1", "length": 300, "sequence": "MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV" }, "uniprot_id": "PSB11_HUMAN", "enzyme_annotation": [ { "ec": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity." }, { "ec": "3.4.25.1", "activity": "" } ], "synonyms": { "protein": { "refseq": [ "proteasome subunit beta type-11 precursor", "proteasome subunit beta 5T; proteasome subunit beta type-11; proteasome subunit beta-5t; proteasome (prosome, macropain) subunit, beta type, 11" ], "uniprotkb": [ "Proteasome subunit beta type-11", "3.4.25.1", "Proteasome subunit beta-5t" ] }, "gene": { "refseq": [ "PSMB11", "BETA5T" ], "uniprotkb": [ "PSMB11", "BETA5T" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Proteasome subunit beta type-11; 3.4.25.1; Proteasome subunit beta-5t." }, "publication": [ { "title": "Decreased expression of thymus-specific proteasome subunit beta5t in Down syndrome patients.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/25556590", "journal": "Histopathology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Tomaru U, Tsuji T, Kiuchi S, Ishizu A, Suzuki A, Otsuka N, Ito T, Ikeda H, Fukasawa Y, Kasahara M", "date": "2015", "pmid": "25556590" }, { "title": "Expression of thymoproteasome subunit beta5t in type AB thymoma.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/24293611", "journal": "Journal of clinical pathology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Yamada Y, Tomaru U, Ishizu A, Kiuchi T, Kasahara M, Matsuno Y", "date": "2014", "pmid": "24293611" }, { "title": "Impaired bortezomib binding to mutant beta5 subunit of the proteasome is the underlying basis for bortezomib resistance in leukemia cells.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21941364", "journal": "Leukemia", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Franke NE, Niewerth D, Assaraf YG, van Meerloo J, Vojtekova K, van Zantwijk CH, Zweegman S, Chan ET, Kirk CJ, Geerke DP, Schimmer AD, Kaspers GJ, Jansen G, Cloos J", "date": "2012", "pmid": "21941364" }, { "title": "Expression of proteasome subunit beta5t in thymic epithelial tumors.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21836487", "journal": "The American journal of surgical pathology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Yamada Y, Tomaru U, Ishizu A, Kiuchi T, Marukawa K, Matsuno Y, Kasahara M", "date": "2011", "pmid": "21836487" }, { "title": "Exclusive expression of proteasome subunit {beta}5t in the human thymic cortex.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19289856", "journal": "Blood", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Tomaru U, Ishizu A, Murata S, Miyatake Y, Suzuki S, Takahashi S, Kazamaki T, Ohara J, Baba T, Iwasaki S, Fugo K, Otsuka N, Tanaka K, Kasahara M", "date": "2009", "pmid": "19289856" }, { "title": "Regulation of CD8+ T cell development by thymus-specific proteasomes.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17540904", "journal": "Science (New York, N.Y.)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A5LHX3/publications", "id": "A5LHX3", "database": "UniProtKB" } ], "authors": "Murata S, Sasaki K, Kishimoto T, Niwa S, Hayashi H, Takahama Y, Tanaka K", "date": "2007", "pmid": "17540904" }, { "title": "Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/12791267", "journal": "Developmental cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Margottin-Goguet F, Hsu JY, Loktev A, Hsieh HM, Reimann JD, Jackson PK", "date": "2003", "pmid": "12791267" }, { "title": "Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/11285280", "journal": "The Journal of cell biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Geley S, Kramer E, Gieffers C, Gannon J, Peters JM, Hunt T", "date": "2001", "pmid": "11285280" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3#A5LHX3-1", "isoform_ac": "A5LHX3-1", "locus": { "end_pos": 23042226, "start_pos": 23043125, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000408907", "id": "ENST00000408907", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000386212", "id": "ENSP00000386212", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A5LHX3-1|PSB11_HUMAN Isoform 1 of Proteasome subunit beta type-11 OS=Homo sapiens OX=9606 GN=PSMB11 PE=2 SV=1 CANONICAL=A5LHX3-1", "length": 300, "sequence": "MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:122706", "resource": "KEGG Pathway", "id": "hsa:122706", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253", "resource": "Reactome", "id": "R-HSA-195253", "name": "Degradation of beta-catenin by the destruction complex" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "resource": "Reactome", "id": "R-HSA-1169091", "name": "Activation of NF-kappaB in B cells" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176", "resource": "Reactome", "id": "R-HSA-1234176", "name": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "id": "R-HSA-1236974", "name": "ER-Phagosome pathway" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978", "resource": "Reactome", "id": "R-HSA-1236978", "name": "Cross-presentation of soluble exogenous antigens (endosomes)" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258", "resource": "Reactome", "id": "R-HSA-4641258", "name": "Degradation of DVL" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113", "resource": "Reactome", "id": "R-HSA-174113", "name": "SCF-beta-TrCP mediated degradation of Emi1" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "resource": "Reactome", "id": "R-HSA-174154", "name": "APC/C:Cdc20 mediated degradation of Securin" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "resource": "Reactome", "id": "R-HSA-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "resource": "Reactome", "id": "R-HSA-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "resource": "Reactome", "id": "R-HSA-2467813", "name": "Separation of Sister Chromatids" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "resource": "Reactome", "id": "R-HSA-180534", "name": "Vpu mediated degradation of CD4" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585", "resource": "Reactome", "id": "R-HSA-180585", "name": "Vif-mediated degradation of APOBEC3G" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "resource": "Reactome", "id": "R-HSA-9020702", "name": "Interleukin-1 signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733", "resource": "Reactome", "id": "R-HSA-211733", "name": "Regulation of activated PAK-2p34 by proteasome mediated degradation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425", "resource": "Reactome", "id": "R-HSA-349425", "name": "Autodegradation of the E3 ubiquitin ligase COP1" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562", "resource": "Reactome", "id": "R-HSA-350562", "name": "Regulation of ornithine decarboxylase (ODC)" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257", "resource": "Reactome", "id": "R-HSA-4641257", "name": "Degradation of AXIN" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "resource": "Reactome", "id": "R-HSA-450408", "name": "AUF1 (hnRNP D0) binds and destabilizes mRNA" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870", "resource": "Reactome", "id": "R-HSA-4608870", "name": "Asymmetric localization of PCP proteins" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "resource": "Reactome", "id": "R-HSA-202424", "name": "Downstream TCR signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "resource": "Reactome", "id": "R-HSA-2871837", "name": "FCERI mediated NF-kB activation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346", "resource": "Reactome", "id": "R-HSA-5358346", "name": "Hedgehog ligand biogenesis" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768", "resource": "Reactome", "id": "R-HSA-5362768", "name": "Hh mutants that don't undergo autocatalytic processing are degraded by ERAD" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "resource": "Reactome", "id": "R-HSA-5607764", "name": "CLEC7A (Dectin-1) signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761", "resource": "Reactome", "id": "R-HSA-5607761", "name": "Dectin-1 mediated noncanonical NF-kB signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783", "resource": "Reactome", "id": "R-HSA-5610783", "name": "Degradation of GLI2 by the proteasome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785", "resource": "Reactome", "id": "R-HSA-5610785", "name": "GLI3 is processed to GLI3R by the proteasome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590", "resource": "Reactome", "id": "R-HSA-5676590", "name": "NIK-->noncanonical NF-kB signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780", "resource": "Reactome", "id": "R-HSA-5610780", "name": "Degradation of GLI1 by the proteasome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684", "resource": "Reactome", "id": "R-HSA-5632684", "name": "Hedgehog 'on' state" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442", "resource": "Reactome", "id": "R-HSA-5658442", "name": "Regulation of RAS by GAPs" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "resource": "Reactome", "id": "R-HSA-5689603", "name": "UCH proteinases" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "resource": "Reactome", "id": "R-HSA-5668541", "name": "TNFR2 non-canonical NF-kB pathway" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "resource": "Reactome", "id": "R-HSA-5687128", "name": "MAPK6/MAPK4 signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "id": "R-HSA-5689880", "name": "Ub-specific processing proteases" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68827", "resource": "Reactome", "id": "R-HSA-68827", "name": "CDT1 association with the CDC6:ORC:origin complex" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949", "resource": "Reactome", "id": "R-HSA-68949", "name": "Orc1 removal from chromatin" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "resource": "Reactome", "id": "R-HSA-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601", "resource": "Reactome", "id": "R-HSA-69601", "name": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "resource": "Reactome", "id": "R-HSA-75815", "name": "Ubiquitin-dependent degradation of Cyclin D" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481", "resource": "Reactome", "id": "R-HSA-69481", "name": "G2/M Checkpoints" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "resource": "Reactome", "id": "R-HSA-8852276", "name": "The role of GTSE1 in G2/M progression after G2 checkpoint" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050", "resource": "Reactome", "id": "R-HSA-8854050", "name": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751", "resource": "Reactome", "id": "R-HSA-8948751", "name": "Regulation of PTEN stability and activity" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "resource": "Reactome", "id": "R-HSA-382556", "name": "ABC-family proteins mediated transport" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895", "resource": "Reactome", "id": "R-HSA-5678895", "name": "Defective CFTR causes cystic fibrosis" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "resource": "Reactome", "id": "R-HSA-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902", "resource": "Reactome", "id": "R-HSA-8939902", "name": "Regulation of RUNX2 expression and activity" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "resource": "Reactome", "id": "R-HSA-8951664", "name": "Neddylation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "resource": "Reactome", "id": "R-HSA-9010553", "name": "Regulation of expression of SLITs and ROBOs" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "resource": "Reactome", "id": "R-HSA-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3#function", "annotation": "The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Incorporated instead of PSMB5 or PSMB8, this unit reduces the chymotrypsin-like activity of the proteasome (By similarity). Plays a pivotal role in development of CD8-positive T cells (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3#function", "id": "A5LHX3", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "We analysed thymic tissues from patients with trisomy 13 (n = 4), trisomy 18 (n = 14) and trisomy 21 (n = 13) for histological alterations, and for the expression of functionally important molecules such as beta5t, a thymoproteasome subunit, and cathepsins.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Histological diversity of type AB thymoma correlates with expression of a functional marker beta5t and abundance of TdT-positive lymphocytes.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Provide the first evidence that the mechanism underlying BTZ resistance in these tumor cells is impaired binding of BTZ to the mutant beta5 subunit of the proteasome", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Proteasome beta5t is expressed in most type B and in some type AB thymomas and is a marker useful in differentiating type B3 thymomas from thymic carcinomas when used in combination with other diagnostic markers.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Human beta5t was expressed in approximately 80% of cortical thymic epithelial cells and some cortical dendritic cells", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Results suggest a key role for beta5t in generating the MHC class I-restricted CD8(+) T cell repertoire during thymic selection", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "M0R7C4-1", "protein_name": "Proteasome subunit beta; 3.4.25.1.", "sequence": { "length": 301, "sequence": "MALQDVCKWQAPDTHGLSLRLPQAGGWAVPRGCDPQTFLQIYGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHRHLLGTTSGTSADCATWYRVLRRELRLRELREGQLPSVAGTAKLLSAMMSRYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDVFSVGSGSPYAYGVLDRSYHYDMTVQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESGWEYISRSDACVLYRELQEAQGFEQELEAKASEVLPEPATPQDARESELSVELEEVTPEDCKIIVKTETM" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A5LHX3/", "id": "A5LHX3", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/13729", "id": "13729", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q8BG41-1", "protein_name": "Proteasome subunit beta type-11; 3.4.25.1; Proteasome subunit beta-5t.", "sequence": { "length": 302, "sequence": "MALQDVCKWQTPDTPRPSIHLPQAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHQRLLGTTSGTSADCATWYRVLRRELRLRELREGQLPSVAGTAKLLAAMMSCYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDIFSVGSGSPYAYGVLDRGYHYDMTIQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESGWEYVSRSDACVLYRELQKARSLEQELEAKACGIYPEPATPQGARECKELFVEQEEVTPEDCAIIMKTETM" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A5LHX3/", "id": "A5LHX3", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/13729", "id": "13729", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "ac": "NP_001093250.1", "name": "proteasome subunit beta type-11 precursor; proteasome subunit beta 5T; proteasome subunit beta type-11; proteasome subunit beta-5t; proteasome (prosome, macropain) subunit, beta type, 11.", "summary": "Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1 (PSMB6; MIM 600307), beta-2 (PSMB7; MIM 604030), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i (PSMB9; MIM 177045), beta-2i (PSMB10; MIM 176847), and beta-5i (PSMB8; MIM 177046), are induced by gamma-interferon (IFNG; MIM 147570) and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells (Murata et al., 2007 [PubMed 17540904]).[supplied by OMIM, Mar 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004175", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "endopeptidase activity", "id": "GO:0004175" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "peptidase activity", "id": "GO:0008233" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004298", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "threonine-type endopeptidase activity", "id": "GO:0004298" } ], "total": 3, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005839", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasome core complex", "id": "GO:0005839" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019774", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasome core complex, beta-subunit complex", "id": "GO:0019774" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" } ], "total": 5, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteolysis", "id": "GO:0006508" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010498", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasomal protein catabolic process", "id": "GO:0010498" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010499", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasomal ubiquitin-independent protein catabolic process", "id": "GO:0010499" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070498", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "interleukin-1-mediated signaling pathway", "id": "GO:0070498" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043374", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "CD8-positive, alpha-beta T cell differentiation", "id": "GO:0043374" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "protein deubiquitination", "id": "GO:0016579" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043687", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "post-translational protein modification", "id": "GO:0043687" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "transmembrane transport", "id": "GO:0055085" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000165", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "MAPK cascade", "id": "GO:0000165" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043488", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of mRNA stability", "id": "GO:0043488" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050852", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "T cell receptor signaling pathway", "id": "GO:0050852" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002479", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent", "id": "GO:0002479" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902036", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of hematopoietic stem cell differentiation", "id": "GO:1902036" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031145", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "anaphase-promoting complex-dependent catabolic process", "id": "GO:0031145" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060071", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "Wnt signaling pathway, planar cell polarity pathway", "id": "GO:0060071" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090263", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "positive regulation of canonical Wnt signaling pathway", "id": "GO:0090263" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "protein polyubiquitination", "id": "GO:0000209" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033209", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "tumor necrosis factor-mediated signaling pathway", "id": "GO:0033209" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038061", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "NIK/NF-kappaB signaling", "id": "GO:0038061" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061418", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of transcription from RNA polymerase II promoter in response to hypoxia", "id": "GO:0061418" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901990", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of mitotic cell cycle phase transition", "id": "GO:1901990" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002223", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "stimulatory C-type lectin receptor signaling pathway", "id": "GO:0002223" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010972", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "negative regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010972" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038095", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "Fc-epsilon receptor signaling pathway", "id": "GO:0038095" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006521", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of cellular amino acid metabolic process", "id": "GO:0006521" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031146", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0031146" } ], "total": 28, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31963", "id": "31963", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A5LHX3", "id": "A5LHX3", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A5LHX3", "id": "NX_A5LHX3", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PSMB11", "id": "PSMB11", "database": "GeneCards" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253", "id": "R-HSA-195253", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "id": "R-HSA-1169091", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176", "id": "R-HSA-1234176", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "id": "R-HSA-1236974", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978", "id": "R-HSA-1236978", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258", "id": "R-HSA-4641258", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113", "id": "R-HSA-174113", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "id": "R-HSA-174154", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "id": "R-HSA-174178", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "id": "R-HSA-174184", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "id": "R-HSA-2467813", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "id": "R-HSA-180534", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585", "id": "R-HSA-180585", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "id": "R-HSA-9020702", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733", "id": "R-HSA-211733", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425", "id": "R-HSA-349425", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562", "id": "R-HSA-350562", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257", "id": "R-HSA-4641257", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "id": "R-HSA-450408", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870", "id": "R-HSA-4608870", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "id": "R-HSA-202424", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "id": "R-HSA-2871837", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346", "id": "R-HSA-5358346", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768", "id": "R-HSA-5362768", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "id": "R-HSA-5607764", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761", "id": "R-HSA-5607761", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783", "id": "R-HSA-5610783", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785", "id": "R-HSA-5610785", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590", "id": "R-HSA-5676590", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780", "id": "R-HSA-5610780", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684", "id": "R-HSA-5632684", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442", "id": "R-HSA-5658442", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "id": "R-HSA-5689603", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "id": "R-HSA-5668541", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "id": "R-HSA-5687128", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "id": "R-HSA-5689880", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68827", "id": "R-HSA-68827", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949", "id": "R-HSA-68949", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "id": "R-HSA-69017", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601", "id": "R-HSA-69601", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "id": "R-HSA-75815", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481", "id": "R-HSA-69481", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "id": "R-HSA-8852276", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050", "id": "R-HSA-8854050", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751", "id": "R-HSA-8948751", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "id": "R-HSA-382556", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895", "id": "R-HSA-5678895", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "id": "R-HSA-8939236", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902", "id": "R-HSA-8939902", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "id": "R-HSA-8951664", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "id": "R-HSA-9010553", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "id": "R-HSA-983168", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:122706", "id": "hsa:122706", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/VCKWQAP/", "id": "VCKWQAP", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR034385", "id": "IPR034385", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "id": "IPR029055", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001353", "id": "IPR001353", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR016050", "id": "IPR016050", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR023333", "id": "IPR023333", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000243", "id": "IPR000243", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF00227", "id": "PF00227", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11599:SF48", "id": "PTHR11599:SF48", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A5LHX3", "id": "PR_A5LHX3", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A5LHX3*", "id": "A5LHX3", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/122706", "id": "122706", "database": "GeneID" } ], "expression_disease": [ { "trend": "Down", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ] } ], "uniprot_ac": "A5LHX3", "disease": [], "mass": { "monoisotopic_mass": 32530.0, "chemical_mass": 32530.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "name": "PSMB11; BETA5T.", "locus": { "end_pos": 23044276, "start_pos": 23042167, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000222028", "id": "ENSG00000222028", "database": "Ensembl Gene" } ] } } ] }