{
    "uniprot_canonical_ac": "A4D2G3-1", 
    "sequence": {
        "header": "sp|A4D2G3-1|O2A25_HUMAN Isoform 1 of Olfactory receptor 2A25  OS=Homo sapiens OX=9606 GN=OR2A25 PE=2 SV=2 CANONICAL=A4D2G3-1", 
        "length": 310, 
        "sequence": "MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYFFLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYDRYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEIMAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSICSSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRMLEKKRTS"
    }, 
    "uniprot_id": "O2A25_HUMAN", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "olfactory receptor 2A25", 
                "olfactory receptor, family 2, subfamily A, member 25 pseudogene; olfactory receptor, family 2, subfamily A, member 27; olfactory receptor, family 2, subfamily A, member 24 pseudogene; olfactory receptor 2A27"
            ], 
            "uniprotkb": [
                "Olfactory receptor 2A25", 
                "Olfactory receptor 2A27"
            ]
        }, 
        "gene": {
            "refseq": [
                "OR2A25", 
                "OR2A24P", 
                "OR2A25P", 
                "OR2A27"
            ], 
            "uniprotkb": [
                "OR2A25", 
                "OR2A25P", 
                "OR2A27", 
                "OR2A24P"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Homo sapiens", 
            "taxid": 9606
        }
    ], 
    "recommendedname": {
        "full": "Olfactory receptor 2A25; Olfactory receptor 2A27."
    }, 
    "publication": [
        {
            "title": "Gene variants associated with ischemic stroke: the cardiovascular health study.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/19023099", 
            "journal": "Stroke", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", 
                    "id": "NP_001004488.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Luke MM, O'Meara ES, Rowland CM, Shiffman D, Bare LA, Arellano AR, Longstreth WT Jr, Lumley T, Rice K, Tracy RP, Devlin JJ, Psaty BM", 
            "date": "2009", 
            "pmid": "19023099"
        }, 
        {
            "title": "Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/17975119", 
            "journal": "Arteriosclerosis, thrombosis, and vascular biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", 
                    "id": "NP_001004488.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Shiffman D, O'Meara ES, Bare LA, Rowland CM, Louie JZ, Arellano AR, Lumley T, Rice K, Iakoubova O, Luke MM, Young BA, Malloy MJ, Kane JP, Ellis SG, Tracy RP, Devlin JJ, Psaty BM", 
            "date": "2008", 
            "pmid": "17975119"
        }
    ], 
    "glycosylation": [
        {
            "residue": "Asn", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/", 
                    "id": "", 
                    "database": "PubMed"
                }
            ], 
            "relation": "attached", 
            "position": 4, 
            "glytoucan_ac": "", 
            "type": "N-linked"
        }
    ], 
    "mutation": [
        {
            "start_pos": 105, 
            "subjects_positive": "4", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "2.7", 
            "annotation": "Filters passed (2/5): patient freq. (2.7%); num. of cancers (3).", 
            "sequence_org": "S", 
            "disease": {
                "doid": "2531", 
                "url": "http://disease-ontology.org/term/DOID:2531", 
                "icd10": "", 
                "name": "Hematologic cancer"
            }, 
            "sequence_mut": "C", 
            "subjects_tested": "150", 
            "end_pos": 105, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 71, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "1.5", 
            "annotation": "Filters passed (2/5): patient freq. (1.5%); num. of cancers (4). In dbSNP: rs756605755.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "1324", 
                "url": "http://disease-ontology.org/term/DOID:1324", 
                "icd10": "", 
                "name": "Lung cancer"
            }, 
            "sequence_mut": "T", 
            "subjects_tested": "66", 
            "end_pos": 71, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 104, 
            "subjects_positive": "2", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "1.3", 
            "annotation": "Filters passed (2/5): patient freq. (1.3%); num. of cancers (3).", 
            "sequence_org": "L", 
            "disease": {
                "doid": "2531", 
                "url": "http://disease-ontology.org/term/DOID:2531", 
                "icd10": "", 
                "name": "Hematologic cancer"
            }, 
            "sequence_mut": "F", 
            "subjects_tested": "150", 
            "end_pos": 104, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 104, 
            "subjects_positive": "3", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.4", 
            "annotation": "Filters passed (1/5): num. of cancers (3).", 
            "sequence_org": "L", 
            "disease": {
                "doid": "1319", 
                "url": "http://disease-ontology.org/term/DOID:1319", 
                "icd10": "", 
                "name": "Brain cancer"
            }, 
            "sequence_mut": "F", 
            "subjects_tested": "678", 
            "end_pos": 104, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 250, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "1.1", 
            "annotation": "Filters passed (1/5): patient freq. (1.1%).", 
            "sequence_org": "F", 
            "disease": {
                "doid": "2394", 
                "url": "http://disease-ontology.org/term/DOID:2394", 
                "icd10": "", 
                "name": "Ovarian cancer"
            }, 
            "sequence_mut": "L", 
            "subjects_tested": "93", 
            "end_pos": 250, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 71, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.2", 
            "annotation": "Filters passed (1/5): num. of cancers (4). In dbSNP: rs756605755.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "363", 
                "url": "http://disease-ontology.org/term/DOID:363", 
                "icd10": "", 
                "name": "Uterine cancer"
            }, 
            "sequence_mut": "T", 
            "subjects_tested": "558", 
            "end_pos": 71, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 189, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.1", 
            "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs374373324.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "1319", 
                "url": "http://disease-ontology.org/term/DOID:1319", 
                "icd10": "", 
                "name": "Brain cancer"
            }, 
            "sequence_mut": "V", 
            "subjects_tested": "1042", 
            "end_pos": 189, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 209, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "2.0", 
            "annotation": "Filters passed (1/5): patient freq. (2.0%).", 
            "sequence_org": "A", 
            "disease": {
                "doid": "1612", 
                "url": "http://disease-ontology.org/term/DOID:1612", 
                "icd10": "", 
                "name": "Breast cancer"
            }, 
            "sequence_mut": "P", 
            "subjects_tested": "50", 
            "end_pos": 209, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 189, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.1", 
            "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs374373324.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "11054", 
                "url": "http://disease-ontology.org/term/DOID:11054", 
                "icd10": "", 
                "name": "Urinary bladder cancer"
            }, 
            "sequence_mut": "V", 
            "subjects_tested": "742", 
            "end_pos": 189, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 105, 
            "subjects_positive": "3", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.4", 
            "annotation": "Filters passed (1/5): num. of cancers (3).", 
            "sequence_org": "S", 
            "disease": {
                "doid": "263", 
                "url": "http://disease-ontology.org/term/DOID:263", 
                "icd10": "", 
                "name": "Kidney cancer"
            }, 
            "sequence_mut": "C", 
            "subjects_tested": "756", 
            "end_pos": 105, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 143, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "1.0", 
            "annotation": "Filters passed (1/5): patient freq. (1.0%).", 
            "sequence_org": "L", 
            "disease": {
                "doid": "11054", 
                "url": "http://disease-ontology.org/term/DOID:11054", 
                "icd10": "", 
                "name": "Urinary bladder cancer"
            }, 
            "sequence_mut": "M", 
            "subjects_tested": "103", 
            "end_pos": 143, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 104, 
            "subjects_positive": "3", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.4", 
            "annotation": "Filters passed (1/5): num. of cancers (3).", 
            "sequence_org": "L", 
            "disease": {
                "doid": "263", 
                "url": "http://disease-ontology.org/term/DOID:263", 
                "icd10": "", 
                "name": "Kidney cancer"
            }, 
            "sequence_mut": "F", 
            "subjects_tested": "756", 
            "end_pos": 104, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 105, 
            "subjects_positive": "5", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.7", 
            "annotation": "Filters passed (1/5): num. of cancers (3).", 
            "sequence_org": "S", 
            "disease": {
                "doid": "1319", 
                "url": "http://disease-ontology.org/term/DOID:1319", 
                "icd10": "", 
                "name": "Brain cancer"
            }, 
            "sequence_mut": "C", 
            "subjects_tested": "678", 
            "end_pos": 105, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 69, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.2", 
            "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs757511266.", 
            "sequence_org": "D", 
            "disease": {
                "doid": "363", 
                "url": "http://disease-ontology.org/term/DOID:363", 
                "icd10": "", 
                "name": "Uterine cancer"
            }, 
            "sequence_mut": "N", 
            "subjects_tested": "558", 
            "end_pos": 69, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 69, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.6", 
            "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs757511266.", 
            "sequence_org": "D", 
            "disease": {
                "doid": "9256", 
                "url": "http://disease-ontology.org/term/DOID:9256", 
                "icd10": "", 
                "name": "Colorectal cancer"
            }, 
            "sequence_mut": "N", 
            "subjects_tested": "162", 
            "end_pos": 69, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 69, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.1", 
            "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs757511266.", 
            "sequence_org": "D", 
            "disease": {
                "doid": "1324", 
                "url": "http://disease-ontology.org/term/DOID:1324", 
                "icd10": "", 
                "name": "Lung cancer"
            }, 
            "sequence_mut": "N", 
            "subjects_tested": "689", 
            "end_pos": 69, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 71, 
            "subjects_positive": "2", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.4", 
            "annotation": "Filters passed (1/5): num. of cancers (4). In dbSNP: rs756605755.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "9256", 
                "url": "http://disease-ontology.org/term/DOID:9256", 
                "icd10": "", 
                "name": "Colorectal cancer"
            }, 
            "sequence_mut": "T", 
            "subjects_tested": "456", 
            "end_pos": 71, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 71, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.1", 
            "annotation": "Filters passed (1/5): num. of cancers (4). In dbSNP: rs756605755.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "4159", 
                "url": "http://disease-ontology.org/term/DOID:4159", 
                "icd10": "", 
                "name": "Skin cancer"
            }, 
            "sequence_mut": "T", 
            "subjects_tested": "820", 
            "end_pos": 71, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 82, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "2.0", 
            "annotation": "Filters passed (1/5): patient freq. (2.0%).", 
            "sequence_org": "V", 
            "disease": {
                "doid": "1612", 
                "url": "http://disease-ontology.org/term/DOID:1612", 
                "icd10": "", 
                "name": "Breast cancer"
            }, 
            "sequence_mut": "A", 
            "subjects_tested": "50", 
            "end_pos": 82, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 189, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "0.4", 
            "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs374373324.", 
            "sequence_org": "A", 
            "disease": {
                "doid": "9256", 
                "url": "http://disease-ontology.org/term/DOID:9256", 
                "icd10": "", 
                "name": "Colorectal cancer"
            }, 
            "sequence_mut": "V", 
            "subjects_tested": "254", 
            "end_pos": 189, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 278, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "1.1", 
            "annotation": "Filters passed (1/5): patient freq. (1.1%).", 
            "sequence_org": "S", 
            "disease": {
                "doid": "2394", 
                "url": "http://disease-ontology.org/term/DOID:2394", 
                "icd10": "", 
                "name": "Ovarian cancer"
            }, 
            "sequence_mut": "R", 
            "subjects_tested": "93", 
            "end_pos": 278, 
            "type": "Point mutation"
        }, 
        {
            "start_pos": 251, 
            "subjects_positive": "1", 
            "evidence": [
                {
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D2G3", 
                    "id": "A4D2G3", 
                    "database": "BioMuta"
                }
            ], 
            "frequency": "1.0", 
            "annotation": "Filters passed (1/5): patient freq. (1.0%).", 
            "sequence_org": "Y", 
            "disease": {
                "doid": "11054", 
                "url": "http://disease-ontology.org/term/DOID:11054", 
                "icd10": "", 
                "name": "Urinary bladder cancer"
            }, 
            "sequence_mut": "H", 
            "subjects_tested": "103", 
            "end_pos": 251, 
            "type": "Point mutation"
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A4D2G3#A4D2G3-1", 
            "isoform_ac": "A4D2G3-1", 
            "locus": {
                "end_pos": 144074220, 
                "start_pos": 144075149, 
                "chromosome": "7", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENST00000641663", 
                        "id": "ENST00000641663", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSP00000493343", 
                        "id": "ENSP00000493343", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A4D2G3-1|O2A25_HUMAN Isoform 1 of Olfactory receptor 2A25  OS=Homo sapiens OX=9606 GN=OR2A25 PE=2 SV=2 CANONICAL=A4D2G3-1", 
                "length": 310, 
                "sequence": "MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYFFLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYDRYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEIMAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSICSSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRMLEKKRTS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:392138", 
            "resource": "KEGG Pathway", 
            "id": "hsa:392138", 
            "name": ""
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", 
            "resource": "Reactome", 
            "id": "R-HSA-381753", 
            "name": "Olfactory Signaling Pathway"
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A4D2G3#function", 
            "annotation": "Odorant receptor.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A4D2G3#function", 
                    "id": "A4D2G3", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", 
            "annotation": "Observational study of gene-disease association. (HuGE Navigator)", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", 
                    "id": "NP_001004488.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q8VGP6-1", 
            "protein_name": "Olfactory receptor.", 
            "sequence": {
                "length": 310, 
                "sequence": "MGGNQTLITQFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTILGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLMDPAKPISFAGCMTQTFLFLTFAHTECLLLVVMSYDRYVAICHPLRYTAIMSWRVCVILVLTSWILGVLLALVHLVLLLPLPFCGSQKVNHFFCEIIAVLKLACSDTRINELMVLAGAVSVLVGPFSSIVVSYAHILCAILKIKSQQGRQKAFSTCSSHLCVVGLFYGTAIVMYIGPQHGKSNEQKKYLLLFHSLFNPMLNPLIYSLRNKEVKSALKRTLLKEDTS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/17457", 
                    "id": "17457", 
                    "database": "MGI"
                }
            ], 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }, 
        {
            "uniprot_canonical_ac": "D4AEF2-1", 
            "protein_name": "Olfactory receptor.", 
            "sequence": {
                "length": 313, 
                "sequence": "MGGNQTLITQFILLGFPLSPRMQMLLFVLFSLFYAFTLLGNGTILGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLMDPAKPISFAGCMTQTFLFLTFAHTECLLLVVMSYDRYVAICHPLRYTVIMSWRVCVIFVLTSWILGVLLALVHLVLLLPLPFCGSQKVNHFFCEIIAVLKLACSDTRINEVMVLAGAVSVLVGPFSSIVVSYTHILCAILKIKSQQGRQKAFSTCSSHLCVVGLFYGTAIVMYIGPQHGKSNEQKKYLLLFHSLFNPMLNPLIYSLRNKDVKSALKRMLIKEDTSSGC"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/17457", 
                    "id": "17457", 
                    "database": "MGI"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", 
        "ac": "NP_001004488.1", 
        "name": "olfactory receptor 2A25; olfactory receptor, family 2, subfamily A, member 25 pseudogene; olfactory receptor, family 2, subfamily A, member 27; olfactory receptor, family 2, subfamily A, member 24 pseudogene; olfactory receptor 2A27.", 
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]."
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                                "id": "A4D2G3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "G protein-coupled receptor activity", 
                        "id": "GO:0004930"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                                "id": "A4D2G3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "olfactory receptor activity", 
                        "id": "GO:0004984"
                    }
                ], 
                "total": 2, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                                "id": "A4D2G3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "plasma membrane", 
                        "id": "GO:0005886"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                                "id": "A4D2G3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "integral component of membrane", 
                        "id": "GO:0016021"
                    }
                ], 
                "total": 2, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A4D2G3", 
                                "id": "A4D2G3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "G protein-coupled receptor signaling pathway", 
                        "id": "GO:0007186"
                    }
                ], 
                "total": 1, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 6, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 4
        }, 
        {
            "end_pos": 43, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 41
        }
    ], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004488.1", 
            "id": "NP_001004488.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=19562", 
            "id": "19562", 
            "database": "HGNC"
        }, 
        {
            "url": "https://pharos.nih.gov/targets/A4D2G3", 
            "id": "A4D2G3", 
            "database": "PHAROS"
        }, 
        {
            "url": "https://www.nextprot.org/entry/NX_A4D2G3", 
            "id": "NX_A4D2G3", 
            "database": "neXtProt"
        }, 
        {
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR2A25", 
            "id": "OR2A25", 
            "database": "GeneCards"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", 
            "id": "R-HSA-381753", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:392138", 
            "id": "hsa:392138", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/CAILKIQ/", 
            "id": "CAILKIQ", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", 
            "id": "IPR000276", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", 
            "id": "IPR017452", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", 
            "id": "IPR000725", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF13853", 
            "id": "PF13853", 
            "database": "Pfam"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A4D2G3", 
            "id": "PR_A4D2G3", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/392138", 
            "id": "392138", 
            "database": "GeneID"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A4D2G3", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 34606.0, 
        "chemical_mass": 34606.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A4D2G3", 
            "name": "OR2A25; OR2A25P; OR2A27; OR2A24P.", 
            "locus": {
                "end_pos": 144075870, 
                "start_pos": 144069811, 
                "chromosome": "7", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSG00000221933", 
                        "id": "ENSG00000221933", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}