{ "uniprot_canonical_ac": "A4D0Y5-1", "sequence": { "header": "sp|A4D0Y5-1|CG077_HUMAN Isoform 1 of Uncharacterized protein C7orf77 OS=Homo sapiens OX=9606 GN=C7orf77 PE=4 SV=1 CANONICAL=A4D0Y5-1", "length": 90, "sequence": "MGAERVCTKAPEITQDEAEIYSLTNMEGNIGIKGCEFKSWLFKFYQARSQVLLCGEVKNPYLLTSNKTTVKEQNACLTHPDRSAMAGLLL" }, "uniprot_id": "CG077_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "uncharacterized protein C7orf77" ], "uniprotkb": [ "Uncharacterized protein C7orf77" ] }, "gene": { "refseq": [ "C7orf77" ], "uniprotkb": [ "C7orf77" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D0Y5", "id": "A4D0Y5", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Uncharacterized protein C7orf77." }, "publication": [ { "title": "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/12477932", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019774.1", "id": "NP_001019774.1", "database": "RefSeq" } ], "authors": "Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA", "date": "2002", "pmid": "12477932" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A4D0Y5#A4D0Y5-1", "isoform_ac": "A4D0Y5-1", "locus": { "end_pos": 124777505, "start_pos": 124790624, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000616258", "id": "ENST00000616258", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000480627", "id": "ENSP00000480627", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A4D0Y5-1|CG077_HUMAN Isoform 1 of Uncharacterized protein C7orf77 OS=Homo sapiens OX=9606 GN=C7orf77 PE=4 SV=1 CANONICAL=A4D0Y5-1", "length": 90, "sequence": "MGAERVCTKAPEITQDEAEIYSLTNMEGNIGIKGCEFKSWLFKFYQARSQVLLCGEVKNPYLLTSNKTTVKEQNACLTHPDRSAMAGLLL" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:154872", "resource": "KEGG Pathway", "id": "hsa:154872", "name": "" } ], "function": [], "orthologs": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019774.1", "ac": "NP_001019774.1", "name": "uncharacterized protein C7orf77.", "summary": "" }, "go_annotation": {}, "site_annotation": [ { "end_pos": 68, "annotation": "n_glycosylation_sequon", "start_pos": 66 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019774.1", "id": "NP_001019774.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51256", "id": "51256", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A4D0Y5", "id": "A4D0Y5", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A4D0Y5", "id": "NX_A4D0Y5", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=C7orf77", "id": "C7orf77", "database": "GeneCards" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:154872", "id": "hsa:154872", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/AERVCIK/", "id": "AERVCIK", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR040904", "id": "IPR040904", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF17712", "id": "PF17712", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A4D0Y5", "id": "PR_A4D0Y5", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/154872", "id": "154872", "database": "GeneID" } ], "expression_disease": [], "uniprot_ac": "A4D0Y5", "disease": [], "mass": { "monoisotopic_mass": 10046.0, "chemical_mass": 10046.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275356", "id": "ENSG00000275356", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A4D0Y5", "name": "C7orf77.", "locus": { "end_pos": 124777292, "start_pos": 124790810, "chromosome": "7", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000275356", "id": "ENSG00000275356", "database": "Ensembl Gene" } ] } } ] }