{ "uniprot_canonical_ac": "A2RU14-1", "sequence": { "header": "sp|A2RU14-1|TM218_HUMAN Isoform 1 of Transmembrane protein 218 OS=Homo sapiens OX=9606 GN=TMEM218 PE=1 SV=1 CANONICAL=A2RU14-1", "length": 115, "sequence": "MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEVKIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY" }, "uniprot_id": "TM218_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "transmembrane protein 218 isoform 2" ], "uniprotkb": [ "Transmembrane protein 218" ] }, "gene": { "refseq": [ "TMEM218" ], "uniprotkb": [ "TMEM218" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RU14", "id": "A2RU14", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Transmembrane protein 218." }, "publication": [ { "title": "A proteome-scale map of the human interactome network.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/25416956", "journal": "Cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074015.1", "id": "NP_001074015.1", "database": "RefSeq" } ], "authors": "Rolland T, Tasan M, Charloteaux B, Pevzner SJ, Zhong Q, Sahni N, Yi S, Lemmens I, Fontanillo C, Mosca R, Kamburov A, Ghiassian SD, Yang X, Ghamsari L, Balcha D, Begg BE, Braun P, Brehme M, Broly MP, Carvunis AR, Convery-Zupan D, Corominas R, Coulombe-Huntington J, Dann E, Dreze M, Dricot A, Fan C, Franzosa E, Gebreab F, Gutierrez BJ, Hardy MF, Jin M, Kang S, Kiros R, Lin GN, Luck K, MacWilliams A, Menche J, Murray RR, Palagi A, Poulin MM, Rambout X, Rasla J, Reichert P, Romero V, Ruyssinck E, Sahalie JM, Scholz A, Shah AA, Sharma A, Shen Y, Spirohn K, Tam S, Tejeda AO, Trigg SA, Twizere JC, Vega K, Walsh J, Cusick ME, Xia Y, Barabasi AL, Iakoucheva LM, Aloy P, De Las Rivas J, Tavernier J, Calderwood MA, Hill DE, Hao T, Roth FP, Vidal M", "date": "2014", "pmid": "25416956" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2RU14#A2RU14-1", "isoform_ac": "A2RU14-1", "locus": { "end_pos": 125097609, "start_pos": 125102241, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000527766", "id": "ENST00000527766", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000435526", "id": "ENSP00000435526", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2RU14-1|TM218_HUMAN Isoform 1 of Transmembrane protein 218 OS=Homo sapiens OX=9606 GN=TMEM218 PE=1 SV=1 CANONICAL=A2RU14-1", "length": 115, "sequence": "MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEVKIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY" } }, { "url": "https://www.uniprot.org/uniprot/A2RU14#B7ZM54-1", "isoform_ac": "B7ZM54-1", "locus": { "end_pos": 125101232, "start_pos": 125102241, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000532156", "id": "ENST00000532156", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000433023", "id": "ENSP00000433023", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|B7ZM54-1|TM218_HUMAN Computationally mapped isoform of Transmembrane protein 218 OS=Homo sapiens OX=9606 GN=TMEM218 PE=1 SV=1 CANONICAL=A2RU14-1", "length": 45, "sequence": "MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAASSVAFPASW" } }, { "url": "https://www.uniprot.org/uniprot/A2RU14#E9PL96-1", "isoform_ac": "E9PL96-1", "locus": { "end_pos": 125101204, "start_pos": 125102241, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000533273", "id": "ENST00000533273", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000431411", "id": "ENSP00000431411", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9PL96-1|TM218_HUMAN Computationally mapped isoform of Transmembrane protein 218 OS=Homo sapiens OX=9606 GN=TMEM218 PE=1 SV=1 CANONICAL=A2RU14-1", "length": 70, "sequence": "MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEV" } }, { "url": "https://www.uniprot.org/uniprot/A2RU14#E9PI23-1", "isoform_ac": "E9PI23-1", "locus": { "end_pos": 125097609, "start_pos": 125102241, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000528724", "id": "ENST00000528724", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000436578", "id": "ENSP00000436578", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9PI23-1|TM218_HUMAN Computationally mapped isoform of Transmembrane protein 218 OS=Homo sapiens OX=9606 GN=TMEM218 PE=1 SV=1 CANONICAL=A2RU14-1", "length": 141, "sequence": "MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARNWELPRINGNAPSWYLSRKKDFGMKRFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEVKIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY" } }, { "url": "https://www.uniprot.org/uniprot/A2RU14#E9PQM6-1", "isoform_ac": "E9PQM6-1", "locus": { "end_pos": 125101258, "start_pos": 125102241, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000529530", "id": "ENST00000529530", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000436151", "id": "ENSP00000436151", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9PQM6-1|TM218_HUMAN Computationally mapped isoform of Transmembrane protein 218 OS=Homo sapiens OX=9606 GN=TMEM218 PE=1 SV=8 CANONICAL=A2RU14-1", "length": 52, "sequence": "MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:219854", "resource": "KEGG Pathway", "id": "hsa:219854", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2RU14#function", "annotation": "May be involved in ciliary biogenesis or function.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RU14#function", "id": "A2RU14", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q9CQ44-1", "protein_name": "Transmembrane protein 218.", "sequence": { "length": 115, "sequence": "MAGMVLGVGAGVFLLALIWVLVLLLCVLLSRASGIARFSIVFVFLGALIITTVLLLFPRASEFPAPEGEMKIVDAFFIGRYVLLAFLSAVFLGGLFLLLTHHLLEPIYAKPLRSC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/11941", "id": "11941", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q5U3Y9-1", "protein_name": "Transmembrane protein 218.", "sequence": { "length": 115, "sequence": "MAGMVLGVGAGVFLLALLWVLVLLLCVLLCRASGIARFSIIFVFLGALIITTVLLLFPRASEFPAPQGEMKIVDAFFIGRYVLLAFLSAVFLGGLFLLLTHHVLEPIYAKPLRSC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/11941", "id": "11941", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074015.1", "ac": "NP_001074015.1", "name": "transmembrane protein 218 isoform 2.", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005929", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RU14", "id": "A2RU14", "database": "UniProtKB" } ], "name": "cilium", "id": "GO:0005929" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RU14", "id": "A2RU14", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" } ], "total": 2, "name": "Cellular Component" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074015.1", "id": "NP_001074015.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=27344", "id": "27344", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A2RU14", "id": "A2RU14", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A2RU14", "id": "NX_A2RU14", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TMEM218", "id": "TMEM218", "database": "GeneCards" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:219854", "id": "hsa:219854", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026771", "id": "IPR026771", "database": "InterPro" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31622", "id": "PTHR31622", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2RU14", "id": "PR_A2RU14", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A2RU14*", "id": "A2RU14", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/219854", "id": "219854", "database": "GeneID" } ], "expression_disease": [ { "trend": "Up", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RU14", "id": "A2RU14", "database": "BioXpress" } ] } ], "uniprot_ac": "A2RU14", "disease": [], "mass": { "monoisotopic_mass": 12459.0, "chemical_mass": 12459.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150433", "id": "ENSG00000150433", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2RU14", "name": "TMEM218.", "locus": { "end_pos": 125096545, "start_pos": 125111763, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000150433", "id": "ENSG00000150433", "database": "Ensembl Gene" } ] } } ] }