{
    "uniprot_canonical_ac": "A2AWP0-1", 
    "sequence": {
        "header": "sp|A2AWP0-1|BIRC7_MOUSE Isoform 1 of Baculoviral IAP repeat-containing protein 7  OS=Mus musculus OX=10090 GN=Birc7 PE=2 SV=1 CANONICAL=A2AWP0-1", 
        "length": 285, 
        "sequence": "MFSPADLFRAAVFSMGPESRARDSVRGPELSHREDGSGRTQEQDKPHCPCNHVLGQDCLDGQILGQLRPLSEEEESSGAAFLGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQTYTPLLGSWDQREEPEDAVSATPSAPAHGSPELLRSRRETQPEDVSEPGAKDVQEQLRQLQEERRCKVCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCVRTFLS"
    }, 
    "uniprot_id": "BIRC7_MOUSE", 
    "enzyme_annotation": [
        {
            "ec": "2.3.2.27", 
            "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine."
        }, 
        {
            "ec": "2.3.2.27", 
            "activity": ""
        }
    ], 
    "synonyms": {
        "protein": {
            "refseq": [
                "baculoviral IAP repeat-containing protein 7 precursor", 
                "baculoviral IAP repeat-containing protein 7; RING-type E3 ubiquitin transferase BIRC7"
            ], 
            "uniprotkb": [
                "Baculoviral IAP repeat-containing protein 7", 
                "2.3.2.27", 
                "Livin", 
                "RING-type E3 ubiquitin transferase BIRC7"
            ]
        }, 
        "gene": {
            "refseq": [
                "Birc7", 
                "E130019N06", 
                "KIAP", 
                "Livin", 
                "ML-IAP"
            ], 
            "uniprotkb": [
                "Birc7", 
                "Livin", 
                "E130019N06", 
                "KIAP", 
                "ML-IAP"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                    "id": "A2AWP0", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "recommendedname": {
        "full": "Baculoviral IAP repeat-containing protein 7; 2.3.2.27; Livin; RING-type E3 ubiquitin transferase BIRC7."
    }, 
    "publication": [
        {
            "title": "Concomitant modulation of PTEN and Livin in gastric cancer treatment.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/29436592", 
            "journal": "International journal of molecular medicine", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Zhao CL, Han SN, Wang ZJ, Wang SH, Zhao GQ, Zhang XF, Wang JX", 
            "date": "2018", 
            "pmid": "29436592"
        }, 
        {
            "title": "Birc7: A Late Fiber Gene of the Crystalline Lens.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/26218911", 
            "journal": "Investigative ophthalmology & visual science", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "De Maria A, Bassnett S", 
            "date": "2015", 
            "pmid": "26218911"
        }, 
        {
            "title": "Silencing of Livin inhibits tumorigenesis and metastasis via VEGF and MMPs pathway in lung cancer.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/26094984", 
            "journal": "International journal of oncology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Lin X, Li HR, Lin XF, Yu ME, Tu XW, Hua ZD, Lin M, Xu NL, Han LL, Chen YS", 
            "date": "2015", 
            "pmid": "26094984"
        }, 
        {
            "title": "Characterization of ML-IAP protein stability and physiological role in vivo.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/22853455", 
            "journal": "The Biochemical journal", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Varfolomeev E, Moradi E, Dynek JN, Zha J, Fedorova AV, Deshayes K, Fairbrother WJ, Newton K, Le Couter J, Vucic D", 
            "date": "2012", 
            "pmid": "22853455"
        }, 
        {
            "title": "The inhibitors of apoptosis: there is more to life than Bcl2.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/14634619", 
            "journal": "Oncogene", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Liston P, Fong WG, Korneluk RG", 
            "date": "2003", 
            "pmid": "14634619"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AWP0#A2AWP0-1", 
            "isoform_ac": "A2AWP0-1", 
            "locus": {
                "end_pos": 180929147, 
                "start_pos": 180933327, 
                "chromosome": "2", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000108875", 
                        "id": "ENSMUST00000108875", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000104503", 
                        "id": "ENSMUSP00000104503", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A2AWP0-1|BIRC7_MOUSE Isoform 1 of Baculoviral IAP repeat-containing protein 7  OS=Mus musculus OX=10090 GN=Birc7 PE=2 SV=1 CANONICAL=A2AWP0-1", 
                "length": 285, 
                "sequence": "MFSPADLFRAAVFSMGPESRARDSVRGPELSHREDGSGRTQEQDKPHCPCNHVLGQDCLDGQILGQLRPLSEEEESSGAAFLGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQTYTPLLGSWDQREEPEDAVSATPSAPAHGSPELLRSRRETQPEDVSEPGAKDVQEQLRQLQEERRCKVCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCVRTFLS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:329581", 
            "resource": "KEGG Pathway", 
            "id": "mmu:329581", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AWP0#function", 
            "annotation": "Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic activity is mediated through the inhibition of caspase-3, -7, and -9, as well as by its E3 ubiquitin-protein ligase activity. As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival. May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions. Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AWP0#function", 
                    "id": "A2AWP0", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
            "annotation": "The overexpression of PTEN concomitant with Livin gene silencing was confirmed as a feasible and effective in vitro and in vivo gene modulation method, which may represent a potential therapeutic strategy for the treatment of Gastric Cancer.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
            "annotation": "Data showed that Livin knock-down suppressed cell proliferation and inhibited cell invasion, accompanied by downregulation of VEGF and MMP-2/-9. Its silencing resulted in the prevention of xenograft tumor formation.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
            "annotation": "Birc7 is a late fiber gene of the mouse lens. Its expression in cells bordering the OFZ is consistent with a role in organelle degradation, a process in which the ubiquitin proteasome pathway has been implicated previously.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
            "annotation": "ML-IAP is dispensable for both normal mouse development and ocular homoeostasis.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
                    "id": "NP_001156719.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "D4A690-1", 
            "protein_name": "Baculoviral IAP repeat-containing 7.", 
            "sequence": {
                "length": 285, 
                "sequence": "MFSPAGLLRAAVLPMGPESKDRDSFCGPELSHREESNGPTQEQHRPHCPCNRVLGQDCLDGQILGQLRPLSEEEESSGATFVGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQAYTPLLGSWEQREEQEDTVSATPSAPTHGSPELLRSRRETQSEDASEPGAEDVQEQLRQLQEERRCKVCLDRAVSVVFVPCGHFVCTECAPNLRLCPICRVPICNCVRTFLS"
            }, 
            "evidence": [
                {
                    "url": "https://omabrowser.org/oma/group/A2AWP0/", 
                    "id": "A2AWP0", 
                    "database": "OMA"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q96CA5-1", 
            "protein_name": "Baculoviral IAP repeat-containing protein 7; 2.3.2.27; Kidney inhibitor of apoptosis protein; KIAP; Melanoma inhibitor of apoptosis protein; ML-IAP; Livin; RING-type E3 ubiquitin transferase BIRC7; RING finger protein 50.", 
            "sequence": {
                "length": 298, 
                "sequence": "MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/51405", 
                    "id": "51405", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A2AWP0/", 
                    "id": "A2AWP0", 
                    "database": "OMA"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
        "ac": "NP_001156719.1", 
        "name": "baculoviral IAP repeat-containing protein 7 precursor; baculoviral IAP repeat-containing protein 7; RING-type E3 ubiquitin transferase BIRC7.", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "ubiquitin protein ligase activity", 
                        "id": "GO:0061630"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043027", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cysteine-type endopeptidase inhibitor activity involved in apoptotic process", 
                        "id": "GO:0043027"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "metal ion binding", 
                        "id": "GO:0046872"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "ubiquitin-protein transferase activity", 
                        "id": "GO:0004842"
                    }
                ], 
                "total": 4, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleus", 
                        "id": "GO:0005634"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cytoplasm", 
                        "id": "GO:0005737"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "Golgi apparatus", 
                        "id": "GO:0005794"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cytosol", 
                        "id": "GO:0005829"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005815", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "microtubule organizing center", 
                        "id": "GO:0005815"
                    }
                ], 
                "total": 5, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043154", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process", 
                        "id": "GO:0043154"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of protein ubiquitination", 
                        "id": "GO:0031398"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990001", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "inhibition of cysteine-type endopeptidase activity involved in apoptotic process", 
                        "id": "GO:1990001"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of cell population proliferation", 
                        "id": "GO:0042127"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of apoptotic process", 
                        "id": "GO:0043066"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein ubiquitination", 
                        "id": "GO:0016567"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070247", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AWP0", 
                                "id": "A2AWP0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of natural killer cell apoptotic process", 
                        "id": "GO:0070247"
                    }
                ], 
                "total": 7, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001156719.1", 
            "id": "NP_001156719.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:329581", 
            "id": "mmu:329581", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038840", 
            "id": "ENSMUSG00000038840", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/WWVLEPP/", 
            "id": "WWVLEPP", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00022", 
            "id": "cd00022", 
            "database": "CDD"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", 
            "id": "IPR001841", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", 
            "id": "IPR013083", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017907", 
            "id": "IPR017907", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001370", 
            "id": "IPR001370", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF00653", 
            "id": "PF00653", 
            "database": "Pfam"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2AWP0", 
            "id": "PR_A2AWP0", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/329581", 
            "id": "329581", 
            "database": "GeneID"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2676458", 
            "id": "2676458", 
            "database": "MGI"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A2AWP0", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 31992.0, 
        "chemical_mass": 31992.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AWP0", 
            "name": "Birc7; Livin; E130019N06; KIAP; ML-IAP.", 
            "locus": {
                "end_pos": 180934010, 
                "start_pos": 180929023, 
                "chromosome": "2", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000038840", 
                        "id": "ENSMUSG00000038840", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}