{
    "uniprot_canonical_ac": "A2A825-1", 
    "sequence": {
        "header": "sp|A2A825-1|CPLN2_MOUSE Isoform 1 of Ciliogenesis and planar polarity effector 2  OS=Mus musculus OX=10090 GN=Cplane2 PE=3 SV=1 CANONICAL=A2A825-1", 
        "length": 258, 
        "sequence": "MARPPMHGSVIVPDWHETVEGKEYLACILRKNRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVPIVHHETTGIQTTVVFWPAKLKASDCVVMFRFEFWDCGESALKKFDHMLPACKENADAFLFLFSFTDRASFEDLPGQLTRVAGEAPGLVKIVIGSKFDQYMHTDVPARDLTAFRQAWELPLFRVKSVPGRRLADGRTLDGRAGLADTAHVLNGLAEQLWHQDQVAAGLLPSSPESAPG"
    }, 
    "uniprot_id": "CPLN2_MOUSE", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "ciliogenesis and planar polarity effector 2", 
                "miro domain-containing protein C1orf89 homolog; REM2- and Rab-like small GTPase 1; REM2 and RAB-like small GTPase 1"
            ], 
            "uniprotkb": [
                "Ciliogenesis and planar polarity effector 2", 
                "REM2- and Rab-like small GTPase 1"
            ]
        }, 
        "gene": {
            "refseq": [
                "Cplane2", 
                "6330545A04Rik", 
                "b2b2804Clo", 
                "b2b2827Clo", 
                "Gm723", 
                "Rsg1"
            ], 
            "uniprotkb": [
                "Cplane2", 
                "Gm723", 
                "Rsg1", 
                "6330545A04Rik", 
                "b2b2804Clo", 
                "b2b2827Clo"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2A825", 
                    "id": "A2A825", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "recommendedname": {
        "full": "Ciliogenesis and planar polarity effector 2; REM2- and Rab-like small GTPase 1."
    }, 
    "publication": [
        {
            "title": "The small GTPase RSG1 controls a final step in primary cilia initiation.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/29038301", 
            "journal": "The Journal of cell biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074643.1", 
                    "id": "NP_001074643.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Agbu SO, Liang Y, Liu A, Anderson KV", 
            "date": "2018", 
            "pmid": "29038301"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2A825#A2A825-1", 
            "isoform_ac": "A2A825-1", 
            "locus": {
                "end_pos": 141214361, 
                "start_pos": 141220083, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000097813", 
                        "id": "ENSMUST00000097813", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000095422", 
                        "id": "ENSMUSP00000095422", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A2A825-1|CPLN2_MOUSE Isoform 1 of Ciliogenesis and planar polarity effector 2  OS=Mus musculus OX=10090 GN=Cplane2 PE=3 SV=1 CANONICAL=A2A825-1", 
                "length": 258, 
                "sequence": "MARPPMHGSVIVPDWHETVEGKEYLACILRKNRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVPIVHHETTGIQTTVVFWPAKLKASDCVVMFRFEFWDCGESALKKFDHMLPACKENADAFLFLFSFTDRASFEDLPGQLTRVAGEAPGLVKIVIGSKFDQYMHTDVPARDLTAFRQAWELPLFRVKSVPGRRLADGRTLDGRAGLADTAHVLNGLAEQLWHQDQVAAGLLPSSPESAPG"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:76166", 
            "resource": "KEGG Pathway", 
            "id": "mmu:76166", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A2A825#function", 
            "annotation": "Potential effector of the planar cell polarity signaling pathway. Plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. Involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia. More generally involved in exocytosis in secretory cells (By similarity).", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2A825#function", 
                    "id": "A2A825", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074643.1", 
            "annotation": "RSG1 localizes to the mother centriole in a process that depends on tau tubulin kinase 2 (TTBK2), the CPLANE complex protein Inturned (INTU), and its own GTPase activity. The data suggest a specific role for RSG1 in the final maturation of the mother centriole and ciliary vesicle that allows extension of the ciliary axoneme.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074643.1", 
                    "id": "NP_001074643.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0A0G2K9E9-1", 
            "protein_name": "Ciliogenesis and planar polarity effector 2; Similar to novel protein (Predicted), isoform CRA_b.", 
            "sequence": {
                "length": 258, 
                "sequence": "MARLPMHGSVIVPDWHETVEGKEYLACILRKNRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLKASGRVVMFRFEFWDCGESALKKFDHILPACKEKADAFLFLFSFTDRASFEDLPGQLSRVAGEAPGVVKIVIGSKFDQYMHTDVPERDLTAFRQAWELPLFRVKSVPGRRLADGRTLDGRAGLADTAHVLNGLAEQLWHQDQVAAGLLPSSPENAPG"
            }, 
            "evidence": [
                {
                    "url": "https://omabrowser.org/oma/group/A2A825/", 
                    "id": "A2A825", 
                    "database": "OMA"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q9BU20-1", 
            "protein_name": "Ciliogenesis and planar polarity effector 2; REM2- and Rab-like small GTPase 1.", 
            "sequence": {
                "length": 258, 
                "sequence": "MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/12793", 
                    "id": "12793", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A2A825/", 
                    "id": "A2A825", 
                    "database": "OMA"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074643.1", 
        "ac": "NP_001074643.1", 
        "name": "ciliogenesis and planar polarity effector 2; miro domain-containing protein C1orf89 homolog; REM2- and Rab-like small GTPase 1; REM2 and RAB-like small GTPase 1.", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "GTPase activity", 
                        "id": "GO:0003924"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "GTP binding", 
                        "id": "GO:0005525"
                    }
                ], 
                "total": 2, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleoplasm", 
                        "id": "GO:0005654"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cytoplasm", 
                        "id": "GO:0005737"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036064", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "ciliary basal body", 
                        "id": "GO:0036064"
                    }
                ], 
                "total": 3, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein transport", 
                        "id": "GO:0015031"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cilium assembly", 
                        "id": "GO:0060271"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034613", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cellular protein localization", 
                        "id": "GO:0034613"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006887", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "exocytosis", 
                        "id": "GO:0006887"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031338", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of vesicle fusion", 
                        "id": "GO:0031338"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017157", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2A825", 
                                "id": "A2A825", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of exocytosis", 
                        "id": "GO:0017157"
                    }
                ], 
                "total": 6, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074643.1", 
            "id": "NP_001074643.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:76166", 
            "id": "mmu:76166", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000073733", 
            "id": "ENSMUSG00000073733", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/QLWDCGE/", 
            "id": "QLWDCGE", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", 
            "id": "IPR001806", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", 
            "id": "IPR027417", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR039677", 
            "id": "IPR039677", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF00071", 
            "id": "PF00071", 
            "database": "Pfam"
        }, 
        {
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14983", 
            "id": "PTHR14983", 
            "database": "PANTHER"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2A825", 
            "id": "PR_A2A825", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/76166", 
            "id": "76166", 
            "database": "GeneID"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:1923416", 
            "id": "1923416", 
            "database": "MGI"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A2A825", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 28422.0, 
        "chemical_mass": 28422.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2A825", 
            "name": "Cplane2; Gm723; Rsg1; 6330545A04Rik; b2b2804Clo; b2b2827Clo.", 
            "locus": {
                "end_pos": 0, 
                "start_pos": 0, 
                "chromosome": "0", 
                "evidence": []
            }
        }
    ]
}