{ "uniprot_canonical_ac": "A2A288-1", "sequence": { "header": "sp|A2A288-1|ZC12D_HUMAN Isoform 1 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 527, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPRDLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP" }, "uniprot_id": "ZC12D_HUMAN", "enzyme_annotation": [ { "ec": "3.1.-.-", "activity": "" } ], "synonyms": { "protein": { "refseq": [ "probable ribonuclease ZC3H12D", "tumor suppressor TFL; Zinc finger CCCH domain-containing protein 12D; transformed follicular lymphoma" ], "uniprotkb": [ "Probable ribonuclease ZC3H12D", "3.1.-.-", "Transformed follicular lymphoma", "p34", "Zinc finger CCCH domain-containing protein 12D", "MCP-induced protein 4" ] }, "gene": { "refseq": [ "ZC3H12D", "C6orf95", "dJ281H8.1", "MCPIP4", "p34", "TFL" ], "uniprotkb": [ "ZC3H12D", "C6orf95", "MCPIP4", "TFL", "dJ281H8.1", "p34" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Probable ribonuclease ZC3H12D; 3.1.-.-; Transformed follicular lymphoma; p34; Zinc finger CCCH domain-containing protein 12D; MCP-induced protein 4." }, "publication": [ { "title": "Intact NYN/PIN-Like Domain is Crucial for the Degradation of Inflammation-Related Transcripts by ZC3H12D.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27472830", "journal": "Journal of cellular biochemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Wawro M, Kochan J, Krzanik S, Jura J, Kasza A", "date": "2017", "pmid": "27472830" }, { "title": "ZC3H12D attenuated inflammation responses by reducing mRNA stability of proinflammatory genes.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/26059755", "journal": "Molecular immunology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Zhang H, Wang WC, Chen JK, Zhou L, Wang M, Wang ZD, Yang B, Xia YM, Lei S, Fu EQ, Jiang T", "date": "2015", "pmid": "26059755" }, { "title": "Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/26134560", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2A288/publications", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Huang S, Liu S, Fu JJ, Tony Wang T, Yao X, Kumar A, Liu G, Fu M", "date": "2015", "pmid": "26134560" }, { "title": "Posttranscriptional modulation of cytokine production in T cells for the regulation of excessive inflammation by TFL.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/24415781", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Minagawa K, Wakahashi K, Kawano H, Nishikawa S, Fukui C, Kawano Y, Asada N, Sato M, Sada A, Katayama Y, Matsui T", "date": "2014", "pmid": "24415781" }, { "title": "The putative tumor suppressor Zc3h12d modulates toll-like receptor signaling in macrophages.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22036805", "journal": "Cellular signalling", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Huang S, Qi D, Liang J, Miao R, Minagawa K, Quinn T, Matsui T, Fan D, Liu J, Fu M", "date": "2012", "pmid": "22036805" }, { "title": "Wnt signaling and Dupuytren's disease.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21732829", "journal": "The New England journal of medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Dolmans GH, Werker PM, Hennies HC, Furniss D, Festen EA, Franke L, Becker K, van der Vlies P, Wolffenbuttel BH, Tinschert S, Toliat MR, Nothnagel M, Franke A, Klopp N, Wichmann HE, Nurnberg P, Giele H, Ophoff RA, Wijmenga C", "date": "2011", "pmid": "21732829" }, { "title": "Inhibition of G(1) to S phase progression by a novel zinc finger protein P58(TFL) at P-bodies.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19531561", "journal": "Mol. Cancer Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288/publications", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Nishikawa S., Yamamoto K., Katayama Y., Matsui T., Shimoyama M., Okamura A., Minagawa K., Sada A.", "date": "2009", "pmid": "19531561" }, { "title": "A novel CCCH-zinc finger protein family regulates proinflammatory activation of macrophages.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18178554", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2A288/publications", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Liang J, Wang J, Azfer A, Song W, Tromp G, Kolattukudy PE, Fu M", "date": "2008", "pmid": "18178554" }, { "title": "Deregulation of a possible tumour suppressor gene, ZC3H12D, by translocation of IGK@ in transformed follicular lymphoma with t(2;6)(p12;q25).", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17854321", "journal": "British journal of haematology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2A288/publications", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Minagawa K, Yamamoto K, Nishikawa S, Ito M, Sada A, Yakushijin K, Okamura A, Shimoyama M, Katayama Y, Matsui T", "date": "2007", "pmid": "17854321" }, { "title": "Identification of a novel tumor suppressor gene p34 on human chromosome 6q25.1.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17210687", "journal": "Cancer Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288/publications", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Amos C.I., Liu Y., Wang Y., Wang D., Bierut L.J., Wang M., Yang P., Gazdar A., Minna J., Petersen G.M., de Andrade M., You M., Wiest J.S., Fain P.R., Vikis H.G., Anderson M.W., Jia D., Bailey-Wilson J.E., Mandal D., Seminara D., Gaba C., Govindan R., Kupert E., Pinney S.M., Rothschild H., Schwartz A.G., Viswanathan A.", "date": "2007", "pmid": "17210687" } ], "glycosylation": [], "mutation": [ { "start_pos": 405, "subjects_positive": "5", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "1.4", "annotation": "Filters passed (2/5): patient freq. (1.4%); num. of cancers (3).", "sequence_org": "P", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "S", "subjects_tested": "348", "end_pos": 405, "type": "Point mutation" }, { "start_pos": 405, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (2/5): patient freq. (2.0%); num. of cancers (3).", "sequence_org": "P", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "S", "subjects_tested": "50", "end_pos": 405, "type": "Point mutation" }, { "start_pos": 405, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (2/5): patient freq. (2.0%); num. of cancers (3).", "sequence_org": "P", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "S", "subjects_tested": "50", "end_pos": 405, "type": "Point mutation" }, { "start_pos": 290, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "E", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "V", "subjects_tested": "50", "end_pos": 290, "type": "Point mutation" }, { "start_pos": 525, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "G", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "S", "subjects_tested": "50", "end_pos": 525, "type": "Point mutation" }, { "start_pos": 42, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "R", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "C", "subjects_tested": "50", "end_pos": 42, "type": "Point mutation" }, { "start_pos": 1, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.1", "annotation": "Filters passed (1/5): patient freq. (2.1%).", "sequence_org": "M", "disease": { "doid": "2531", "url": "http://disease-ontology.org/term/DOID:2531", "icd10": "", "name": "Hematologic cancer" }, "sequence_mut": "V", "subjects_tested": "48", "end_pos": 1, "type": "Point mutation" }, { "start_pos": 269, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "1.1", "annotation": "Filters passed (1/5): patient freq. (1.1%).", "sequence_org": "G", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "A", "subjects_tested": "94", "end_pos": 269, "type": "Point mutation" }, { "start_pos": 439, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "R", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "C", "subjects_tested": "50", "end_pos": 439, "type": "Point mutation" }, { "start_pos": 439, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "R", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "H", "subjects_tested": "50", "end_pos": 439, "type": "Point mutation" }, { "start_pos": 46, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "frequency": "1.4", "annotation": "Filters passed (1/5): patient freq. (1.4%).", "sequence_org": "R", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "C", "subjects_tested": "72", "end_pos": 46, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2A288#A2A288-1", "isoform_ac": "A2A288-1", "locus": { "end_pos": 149450686, "start_pos": 149474543, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000409806", "id": "ENST00000409806", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000386616", "id": "ENSP00000386616", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2A288-1|ZC12D_HUMAN Isoform 1 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 527, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPRDLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#B7ZBA4-1", "isoform_ac": "B7ZBA4-1", "locus": { "end_pos": 149459623, "start_pos": 149474543, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000409948", "id": "ENST00000409948", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000387062", "id": "ENSP00000387062", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|B7ZBA4-1|ZC12D_HUMAN Computationally mapped isoform of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1 CANONICAL=A2A288-1", "length": 167, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIRGIGMGNEWRSILLGAAARE" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#A2A288-3", "isoform_ac": "A2A288-3", "locus": { "end_pos": 0, "start_pos": 0, "chromosome": "", "evidence": [] }, "sequence": { "header": "sp|A2A288-3|ZC12D_HUMAN Isoform 3 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 227, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDR" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#H0Y4Y6-1", "isoform_ac": "H0Y4Y6-1", "locus": { "end_pos": 149452609, "start_pos": 149456869, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000458251", "id": "ENST00000458251", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000395209", "id": "ENSP00000395209", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|H0Y4Y6-1|ZC12D_HUMAN Computationally mapped isoform of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1 CANONICAL=A2A288-1", "length": 106, "sequence": "XAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGG" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#A2A288-4", "isoform_ac": "A2A288-4", "locus": { "end_pos": 0, "start_pos": 0, "chromosome": "", "evidence": [] }, "sequence": { "header": "sp|A2A288-4|ZC12D_HUMAN Isoform 4 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 321, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPVLPGRPPASARPAAPAAGRTPP" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:340152", "resource": "KEGG Pathway", "id": "hsa:340152", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2A288#function", "annotation": "May regulate cell growth likely by suppressing RB1 phosphorylation (PubMed:19531561). May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages (PubMed:26134560). Serve as a tumor suppressor in certain leukemia cells (PubMed:17210687). Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation (PubMed:19531561).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288#function", "id": "A2A288", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "Overexpression of ZC3H12D increases the turnover rate of transcripts containing ZC3H12A 3'UTR.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "The data indicated that ZC3H12D could suppress both the initial inflammation storm and chronic inflammation by targeting the mRNA of cytokines as well as NF-kappaB and c-fos.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "MCPIP1 and MCPIP4 form a complex but they act independently in regulation of IL-6 mRNA degradation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "Zc3h12d is a novel negative feedback regulator of TLR signaling and macrophage activation and thus may play a role in host immunity and inflammatory diseases.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "D4A0I4-1", "protein_name": "Similar to zinc finger CCCH-type containing 12D; Zinc finger CCCH type-containing 12D.", "sequence": { "length": 533, "sequence": "MERRGKMEFFQKLGYSQEDVVRVLGKLGDGALVNDVLQELIQTGSRPKAQEDPANGTGIVLMPRGCCGVRDSAQQGLGLGLEEAGGDPASFLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFRDRGHTYIKVFVPSWRKEPSRSDTPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKLAYEKDGVIVSNDNYRDLQNENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFLSKKPRPPEPSWQHCPYGKKCTYGVKCRFYHPERPHQGQLPVADELRAKTRAWPGGGAGESRPPSARSRPGAARPLPLEPGAHNPTPAPQPAALTALNQSFARLTFSDTAASGVVSLSRGPDRMPTSGPTSWASPSLRAGSVATQGSPGLRCLRTPNSLLSPGDLGSPICPQSQPSDRHCSRGMHSDLPPQRRPPEDPWAFLPSSYGYLNHSVWAESAWSENTFGRPSGSAQSTINSGGTRASLCSAFPSDREDPVMASDPVLSDVALRTLLQRSQKTGAPLGDP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/18225", "id": "18225", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2A288/", "id": "A2A288", "database": "OMA" } ], "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q8BIY3-1", "protein_name": "Probable ribonuclease ZC3H12D; 3.1.-.-; Zinc finger CCCH domain-containing protein 12D; Transformed follicular lymphoma homolog; MCP-induced protein 4.", "sequence": { "length": 533, "sequence": "MEHRSKMEFFQKLGYSQEDVVRVLGKLGDSALVNDVLQELIQTGSRPRAQEDPASGTGVVLIPRGCCGVQDSAQQGPGTRPRRGWRRSSPLLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFTDRGHTYIKVFVPSWRKEPSRSDTPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKVAYEKDGIIVSNDNYRDLQNENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFLSKKPRPPEPSWQHCPYGKKCTYGVKCRFYHPERPHHGQLSVADELRAKTRAWLGGGAEEPRTPSARSRPTTARLLPQEPGEHDLPPAPQPAVLAALNRSFARLTFSDTAASGVVSQSRGPDWMPTGVPTSWAPPSLRAGSAATIGLPGMRSLRTPNNPLSPGDLGSPICPQARLSERHRSRDMHSDLPPQRRPLEDPWALLPSSYCYLNHSVWSESAWGEDIFRGPSESAQPVANGGGTRPVHCSFFPPDQDHPVMASGPPLSDMALLTLLQRSQKTGAPLGDP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/18225", "id": "18225", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "ac": "NP_997243.2", "name": "probable ribonuclease ZC3H12D; tumor suppressor TFL; Zinc finger CCCH domain-containing protein 12D; transformed follicular lymphoma.", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004519", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "endonuclease activity", "id": "GO:0004519" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "P-body", "id": "GO:0000932" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036464", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "cytoplasmic ribonucleoprotein granule", "id": "GO:0036464" } ], "total": 5, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "negative regulation of cell growth", "id": "GO:0030308" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000134", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "negative regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000134" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061158", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "3'-UTR-mediated mRNA destabilization", "id": "GO:0061158" } ], "total": 3, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=21175", "id": "21175", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A2A288", "id": "A2A288", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A2A288", "id": "NX_A2A288", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ZC3H12D", "id": "ZC3H12D", "database": "GeneCards" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:340152", "id": "hsa:340152", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/RPPDDPW/", "id": "RPPDDPW", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000571", "id": "IPR000571", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR021869", "id": "IPR021869", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR040546", "id": "IPR040546", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF11977", "id": "PF11977", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF18039", "id": "PF18039", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2A288", "id": "PR_A2A288", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/340152", "id": "340152", "database": "GeneID" } ], "expression_disease": [ { "trend": "Down", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ] } ], "uniprot_ac": "A2A288", "disease": [], "mass": { "monoisotopic_mass": 58078.0, "chemical_mass": 58078.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "name": "ZC3H12D; C6orf95; MCPIP4; TFL; dJ281H8.1; p34.", "locus": { "end_pos": 149446795, "start_pos": 149485061, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000178199", "id": "ENSG00000178199", "database": "Ensembl Gene" } ] } } ] }