{ "uniprot_canonical_ac": "A1L4L8-1", "sequence": { "header": "sp|A1L4L8-1|PL8L1_HUMAN Isoform 1 of PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PLAC8L1 PE=2 SV=1 CANONICAL=A1L4L8-1", "length": 177, "sequence": "MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTGGGWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLLPGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV" }, "uniprot_id": "PL8L1_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "PLAC8-like protein 1" ], "uniprotkb": [ "PLAC8-like protein 1" ] }, "gene": { "refseq": [ "PLAC8L1" ], "uniprotkb": [ "PLAC8L1" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L4L8", "id": "A1L4L8", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "PLAC8-like protein 1." }, "publication": [ { "title": "Common functions or only phylogenetically related? The large family of PLAC8 motif-containing/PCR genes.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21347707", "journal": "Molecules and cells", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025040.1", "id": "NP_001025040.1", "database": "RefSeq" } ], "authors": "Song WY, Hortensteiner S, Tomioka R, Lee Y, Martinoia E", "date": "2011", "pmid": "21347707" }, { "title": "Evolution of FW2.2-like (FWL) and PLAC8 genes in eukaryotes.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/20855956", "journal": "Plant signaling & behavior", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025040.1", "id": "NP_001025040.1", "database": "RefSeq" } ], "authors": "Libault M, Stacey G", "date": "2010", "pmid": "20855956" } ], "glycosylation": [], "mutation": [ { "start_pos": 11, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L4L8", "id": "A1L4L8", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "C", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "S", "subjects_tested": "50", "end_pos": 11, "type": "Point mutation" }, { "start_pos": 13, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L4L8", "id": "A1L4L8", "database": "BioMuta" } ], "frequency": "1.0", "annotation": "Filters passed (1/5): patient freq. (1.0%).", "sequence_org": "E", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "Urinary bladder cancer" }, "sequence_mut": "*", "subjects_tested": "103", "end_pos": 13, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L4L8#A1L4L8-1", "isoform_ac": "A1L4L8-1", "locus": { "end_pos": 146084435, "start_pos": 146104311, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000311450", "id": "ENST00000311450", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000309087", "id": "ENSP00000309087", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1L4L8-1|PL8L1_HUMAN Isoform 1 of PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PLAC8L1 PE=2 SV=1 CANONICAL=A1L4L8-1", "length": 177, "sequence": "MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTGGGWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLLPGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV" } }, { "url": "https://www.uniprot.org/uniprot/A1L4L8#D6RBV4-1", "isoform_ac": "D6RBV4-1", "locus": { "end_pos": 146085561, "start_pos": 146104311, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000512998", "id": "ENST00000512998", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000423992", "id": "ENSP00000423992", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RBV4-1|PL8L1_HUMAN Computationally mapped isoform of PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PLAC8L1 PE=2 SV=1 CANONICAL=A1L4L8-1", "length": 86, "sequence": "MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTGGGWSTGLFSVCRDRRIL" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:153770", "resource": "KEGG Pathway", "id": "hsa:153770", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "D3ZTM1-1", "protein_name": "RCG49364; PLAC8-like 1.", "sequence": { "length": 177, "sequence": "MSWLGHHFSRWCEDISLLSTHIPLFSPMPSEDEHLISDLRSHVPACVVVKQPIRGASGRTTVTAIVQTGGDWSTGLFSVCRDRKICFWGLFCPMCLECDIARHYGECLCWPLLPGSSFALRIGTRERHKIQGTLCEDWVVVHCCWPFSICQVARELKMRTSQLYEICEVPELKDTLV" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A1L4L8/", "id": "A1L4L8", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/45879", "id": "45879", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q08EJ0-1", "protein_name": "PLAC8-like protein 1.", "sequence": { "length": 177, "sequence": "MSWMGHHFSRWCKDISVLSSHLPLFSPMPSEDEHLISNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGGDWSTGLFSVCRDRKICFWGLLCPMCLECDIARHYGECLCWPLLPGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVARELKMRTSQLYEICEVPELKNTLV" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A1L4L8/", "id": "A1L4L8", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/45879", "id": "45879", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025040.1", "ac": "NP_001025040.1", "name": "PLAC8-like protein 1.", "summary": "" }, "go_annotation": {}, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025040.1", "id": "NP_001025040.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31746", "id": "31746", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A1L4L8", "id": "A1L4L8", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A1L4L8", "id": "NX_A1L4L8", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLAC8L1", "id": "PLAC8L1", "database": "GeneCards" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:153770", "id": "hsa:153770", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/RYKIQGT/", "id": "RYKIQGT", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR006461", "id": "IPR006461", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF04749", "id": "PF04749", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15907", "id": "PTHR15907", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L4L8", "id": "PR_A1L4L8", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1L4L8*", "id": "A1L4L8", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/153770", "id": "153770", "database": "GeneID" } ], "expression_disease": [ { "trend": "Down", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4L8", "id": "A1L4L8", "database": "BioXpress" } ] } ], "uniprot_ac": "A1L4L8", "disease": [], "mass": { "monoisotopic_mass": 19885.0, "chemical_mass": 19885.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173261", "id": "ENSG00000173261", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L4L8", "name": "PLAC8L1.", "locus": { "end_pos": 146084386, "start_pos": 146104369, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000173261", "id": "ENSG00000173261", "database": "Ensembl Gene" } ] } } ] }