{ "uniprot_canonical_ac": "A1L3X0-1", "sequence": { "header": "sp|A1L3X0-1|ELOV7_HUMAN Isoform 1 of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 281, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN" }, "uniprot_id": "ELOV7_HUMAN", "enzyme_annotation": [ { "ec": "2.3.1.199", "activity": "A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2)." }, { "ec": "2.3.1.199", "activity": "" } ], "synonyms": { "protein": { "refseq": [ "elongation of very long chain fatty acids protein 7 isoform 1", "elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase ELOVL7; ELOVL FA elongase 7; very long chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids; very long chain 3-ketoacyl-CoA synthase 7" ], "uniprotkb": [ "Elongation of very long chain fatty acids protein 7", "2.3.1.199", "ELOVL fatty acid elongase 7", "ELOVL FA elongase 7", "Very long chain 3-oxoacyl-CoA synthase 7", "3-keto acyl-CoA synthase ELOVL7", "Very long chain 3-ketoacyl-CoA synthase 7" ] }, "gene": { "refseq": [ "ELOVL7" ], "uniprotkb": [ "ELOVL7" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Elongation of very long chain fatty acids protein 7; 2.3.1.199; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very long chain 3-oxoacyl-CoA synthase 7; 3-keto acyl-CoA synthase ELOVL7; Very long chain 3-ketoacyl-CoA synthase 7." }, "publication": [ { "title": "Gene expression signatures for phlegm-dampness constitution of Chinese medicine.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27928700", "journal": "Science China. Life sciences", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Li L, Feng J, Yao H, Xie L, Chen Y, Yang L, Hou S, Zhao S, Sun R, Wu Y, Bai T, Li Y, Yu R, Wang J, Wang Q", "date": "2017", "pmid": "27928700" }, { "title": "Fatty acid elongase 7 catalyzes lipidome remodeling essential for human cytomegalovirus replication.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/25732827", "journal": "Cell reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ], "authors": "Purdy JG, Shenk T, Rabinowitz JD", "date": "2015", "pmid": "25732827" }, { "title": "Biochemical characterization of the very long-chain fatty acid elongase ELOVL7.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/21959040", "journal": "FEBS letters", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0/publications", "id": "A1L3X0", "database": "UniProtKB" } ], "authors": "Naganuma T, Sato Y, Sassa T, Ohno Y, Kihara A", "date": "2011", "pmid": "21959040" }, { "title": "ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/20937905", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0/publications", "id": "A1L3X0", "database": "UniProtKB" } ], "authors": "Ohno Y, Suto S, Yamanaka M, Mizutani Y, Mitsutake S, Igarashi Y, Sassa T, Kihara A", "date": "2010", "pmid": "20937905" }, { "title": "Novel lipogenic enzyme ELOVL7 is involved in prostate cancer growth through saturated long-chain fatty acid metabolism.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19826053", "journal": "Cancer research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1L3X0/publications", "id": "A1L3X0", "database": "UniProtKB" } ], "authors": "Tamura K, Makino A, Hullin-Matsuda F, Kobayashi T, Furihata M, Chung S, Ashida S, Miki T, Fujioka T, Shuin T, Nakamura Y, Nakagawa H", "date": "2009", "pmid": "19826053" } ], "glycosylation": [], "mutation": [ { "start_pos": 98, "subjects_positive": "7", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "1.3", "annotation": "Filters passed (1/5): patient freq. (1.3%).", "sequence_org": "R", "disease": { "doid": "363", "url": "http://disease-ontology.org/term/DOID:363", "icd10": "", "name": "Uterine cancer" }, "sequence_mut": "*", "subjects_tested": "558", "end_pos": 98, "type": "Point mutation" }, { "start_pos": 27, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "D", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "Y", "subjects_tested": "50", "end_pos": 27, "type": "Point mutation" }, { "start_pos": 77, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "L", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "P", "subjects_tested": "50", "end_pos": 77, "type": "Point mutation" }, { "start_pos": 38, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L3X0", "id": "A1L3X0", "database": "BioMuta" } ], "frequency": "1.5", "annotation": "Filters passed (1/5): patient freq. (1.5%). In dbSNP: rs750549527.", "sequence_org": "T", "disease": { "doid": "1324", "url": "http://disease-ontology.org/term/DOID:1324", "icd10": "", "name": "Lung cancer" }, "sequence_mut": "A", "subjects_tested": "66", "end_pos": 38, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0#A1L3X0-1", "isoform_ac": "A1L3X0-1", "locus": { "end_pos": 60754627, "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000425382", "id": "ENST00000425382", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000402634", "id": "ENSP00000402634", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1L3X0-1|ELOV7_HUMAN Isoform 1 of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 281, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RBR5-1", "isoform_ac": "D6RBR5-1", "locus": { "end_pos": 60768682, "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000514809", "id": "ENST00000514809", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000422602", "id": "ENSP00000422602", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RBR5-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 88, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEILF" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RE10-1", "isoform_ac": "D6RE10-1", "locus": { "end_pos": 60767900, "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000504455", "id": "ENST00000504455", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000425127", "id": "ENSP00000425127", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RE10-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 71, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITL" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RHD0-1", "isoform_ac": "D6RHD0-1", "locus": { "end_pos": 60754627, "start_pos": 60784118, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000505959", "id": "ENST00000505959", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000421043", "id": "ENSP00000421043", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RHD0-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 268, "sequence": "MEKPINILYPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN" } }, { "url": "https://www.uniprot.org/uniprot/A1L3X0#D6RBM2-1", "isoform_ac": "D6RBM2-1", "locus": { "end_pos": 60764231, "start_pos": 60787397, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000511799", "id": "ENST00000511799", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000424081", "id": "ENSP00000424081", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RBM2-1|ELOV7_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1", "length": 165, "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFA" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:79993", "resource": "KEGG Pathway", "id": "hsa:79993", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876", "resource": "Reactome", "id": "R-HSA-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0#function", "annotation": "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate in the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0#function", "id": "A1L3X0", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "Data show that ELOVL7, SOCS3, ACSL4 and CLU were upregulated while PRKAR1A and ABCG1 were downregulated in the phlegm-dampness group.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "ELOVL7 knockdown or mTOR inhibition impairs HCMV-induced fatty acid elongation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "Progression of the VLCFA cycle enhances ELOVL7 activity.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "annotation": "Overexpression of ELOVL7 is associated with prostate cancer growth through saturated long-chain fatty acid metabolism.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q9D2Y9-1", "protein_name": "Elongation of very long chain fatty acids protein 7; 2.3.1.199; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very long chain 3-oxoacyl-CoA synthase 7; 3-keto acyl-CoA synthase Elovl7; Very long chain 3-ketoacyl-CoA synthase 7.", "sequence": { "length": 281, "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/23672", "id": "23672", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "D4ADY9-1", "protein_name": "Elongation of very long chain fatty acids protein 7; 2.3.1.199; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very long chain 3-oxoacyl-CoA synthase 7; 3-keto acyl-CoA synthase Elovl7; Very long chain 3-ketoacyl-CoA synthase 7.", "sequence": { "length": 281, "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/23672", "id": "23672", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "ac": "NP_001098028.1", "name": "elongation of very long chain fatty acids protein 7 isoform 1; elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase ELOVL7; ELOVL FA elongase 7; very long chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids; very long chain 3-ketoacyl-CoA synthase 7.", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongase activity", "id": "GO:0009922" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102336", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "3-oxo-arachidoyl-CoA synthase activity", "id": "GO:0102336" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102337", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "3-oxo-cerotoyl-CoA synthase activity", "id": "GO:0102337" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102338", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "3-oxo-lignoceronyl-CoA synthase activity", "id": "GO:0102338" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102756", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "very-long-chain 3-ketoacyl-CoA synthase activity", "id": "GO:0102756" } ], "total": 5, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "endoplasmic reticulum", "id": "GO:0005783" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030176", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "integral component of endoplasmic reticulum membrane", "id": "GO:0030176" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "endoplasmic reticulum membrane", "id": "GO:0005789" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "sphingolipid biosynthetic process", "id": "GO:0030148" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035338", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "long-chain fatty-acyl-CoA biosynthetic process", "id": "GO:0035338" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006636", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0", "database": "UniProtKB" } ], "name": "unsaturated fatty acid biosynthetic process", "id": "GO:0006636" } ], "total": 8, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 275, "annotation": "n_glycosylation_sequon", "start_pos": 273 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028.1", "id": "NP_001098028.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26292", "id": "26292", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A1L3X0", "id": "A1L3X0", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A1L3X0", "id": "NX_A1L3X0", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ELOVL7", "id": "ELOVL7", "database": "GeneCards" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876", "id": "R-HSA-75876", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:79993", "id": "hsa:79993", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/WLFYESC/", "id": "WLFYESC", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR030457", "id": "IPR030457", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "id": "IPR002076", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR033670", "id": "IPR033670", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF01151", "id": "PF01151", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "id": "PTHR11157", "database": "PANTHER" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF118", "id": "PTHR11157:SF118", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L3X0", "id": "PR_A1L3X0", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1L3X0*", "id": "A1L3X0", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/79993", "id": "79993", "database": "GeneID" } ], "expression_disease": [ { "trend": "Up", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0", "id": "A1L3X0", "database": "BioXpress" } ] } ], "uniprot_ac": "A1L3X0", "disease": [], "mass": { "monoisotopic_mass": 33356.0, "chemical_mass": 33356.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "id": "ENSG00000164181", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L3X0", "name": "ELOVL7.", "locus": { "end_pos": 60751791, "start_pos": 60844389, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000164181", "id": "ENSG00000164181", "database": "Ensembl Gene" } ] } } ] }