{
    "uniprot_canonical_ac": "A1L1K1-1", 
    "sequence": {
        "header": "sp|A1L1K1-1|PRR5L_RAT Isoform 1 of Proline-rich protein 5-like  OS=Rattus norvegicus OX=10116 GN=Prr5l PE=2 SV=1 CANONICAL=A1L1K1-1", 
        "length": 370, 
        "sequence": "MTRGLAPLLPIEFHKMGSFRRPRPRFMSSPLLSELPRFQAARQALQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNESIRRLLKSELGSFITDYFQNQLLAKGLSFVEEKIKQCEGDNRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLSQSKLPSSVIQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLGLSGDRSCSRPTHSLARRHSRVRPKVTVLNYASLMTTVGRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEESGSEDKHLLLPPTFPPPHRQCSSEPSILDSPDEMELEDVASGSQEDSELNCASLS"
    }, 
    "uniprot_id": "PRR5L_RAT", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "proline-rich protein 5-like", 
                "protein observed with Rictor-2"
            ], 
            "uniprotkb": [
                "Proline-rich protein 5-like", 
                "Protein observed with Rictor-2", 
                "Protor-2"
            ]
        }, 
        "gene": {
            "refseq": [
                "Prr5l", 
                "Protor-2", 
                "Protor2", 
                "RGD1309969"
            ], 
            "uniprotkb": [
                "Prr5l", 
                "Protor2", 
                "Protor-2", 
                "RGD1309969"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                    "id": "A1L1K1", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Rattus norvegicus", 
            "taxid": 10116
        }
    ], 
    "recommendedname": {
        "full": "Proline-rich protein 5-like; Protein observed with Rictor-2; Protor-2."
    }, 
    "publication": [
        {
            "title": "mTOR signaling in growth control and disease.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/22500797", 
            "journal": "Cell", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073619.1", 
                    "id": "NP_001073619.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Laplante M, Sabatini DM", 
            "date": "2012", 
            "pmid": "22500797"
        }, 
        {
            "title": "PRR5L degradation promotes mTORC2-mediated PKC-delta phosphorylation and cell migration downstream of Galpha12.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/22609986", 
            "journal": "Nature cell biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073619.1", 
                    "id": "NP_001073619.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Gan X, Wang J, Wang C, Sommer E, Kozasa T, Srinivasula S, Alessi D, Offermanns S, Simon MI, Wu D", 
            "date": "2012", 
            "pmid": "22609986"
        }, 
        {
            "title": "Protor-2 interacts with tristetraprolin to regulate mRNA stability during stress.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/21964062", 
            "journal": "Cellular signalling", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073619.1", 
                    "id": "NP_001073619.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Holmes B, Artinian N, Anderson L, Martin J, Masri J, Cloninger C, Bernath A, Bashir T, Benavides-Serrato A, Gera J", 
            "date": "2012", 
            "pmid": "21964062"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A1L1K1#A1L1K1-1", 
            "isoform_ac": "A1L1K1-1", 
            "locus": {
                "end_pos": 0, 
                "start_pos": 0, 
                "chromosome": "", 
                "evidence": []
            }, 
            "sequence": {
                "header": "sp|A1L1K1-1|PRR5L_RAT Isoform 1 of Proline-rich protein 5-like  OS=Rattus norvegicus OX=10116 GN=Prr5l PE=2 SV=1 CANONICAL=A1L1K1-1", 
                "length": 370, 
                "sequence": "MTRGLAPLLPIEFHKMGSFRRPRPRFMSSPLLSELPRFQAARQALQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNESIRRLLKSELGSFITDYFQNQLLAKGLSFVEEKIKQCEGDNRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLSQSKLPSSVIQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLGLSGDRSCSRPTHSLARRHSRVRPKVTVLNYASLMTTVGRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEESGSEDKHLLLPPTFPPPHRQCSSEPSILDSPDEMELEDVASGSQEDSELNCASLS"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A1L1K1#F1LQP5-1", 
            "isoform_ac": "F1LQP5-1", 
            "locus": {
                "end_pos": 91292725, 
                "start_pos": 91349137, 
                "chromosome": "3", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000006291", 
                        "id": "ENSRNOT00000006291", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000006291", 
                        "id": "ENSRNOP00000006291", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|F1LQP5-1|PRR5L_RAT Computationally mapped isoform of Proline-rich protein 5-like  OS=Rattus norvegicus OX=10116 GN=Prr5l PE=2 SV=3 CANONICAL=A1L1K1-1", 
                "length": 370, 
                "sequence": "MTRGLAPLLPIEFHKMGSFRRPRPRFMSSPVLSELPRFQAARQALQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNESIRRLLKSELGSFITDYFQNQLLAKGLSFVEEKIKQCEGDNRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLSQSKLPSSVIQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLGLSGDRSCSRPTHSLARRHSRVRPKVTVLNYASLMTTVGRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEESGSEDKHLLLPPTFPPPHRQCSSEPSILDSPDEMELEDVASGSQEDSELNCASLS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:362171", 
            "resource": "KEGG Pathway", 
            "id": "rno:362171", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A1L1K1#function", 
            "annotation": "Associates with the mTORC2 complex that regulates cellular processes including survival and organization of the cytoskeleton. Regulates the activity of the mTORC2 complex in a substrate-specific manner preventing for instance the specific phosphorylation of PKCs and thereby controlling cell migration. Plays a role in the stimulation of ZFP36-mediated mRNA decay of several ZFP36-associated mRNAs, such as TNF-alpha and GM-CSF, in response to stress. Required for ZFP36 localization to cytoplasmic stress granule (SG) and P-body (PB) in response to stress.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A1L1K1#function", 
                    "id": "A1L1K1", 
                    "database": "UniProtKB"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q6MZQ0-1", 
            "protein_name": "Proline-rich protein 5-like; Protein observed with Rictor-2; Protor-2.", 
            "sequence": {
                "length": 368, 
                "sequence": "MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLEEGARGSQEGSELNCASLS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/11753", 
                    "id": "11753", 
                    "database": "MGI"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }, 
        {
            "uniprot_canonical_ac": "A2AVJ5-1", 
            "protein_name": "Proline-rich protein 5-like; Protein observed with Rictor-2; Protor-2.", 
            "sequence": {
                "length": 370, 
                "sequence": "MTRGLAPLLPIEFHKMGSFRRPRPRFMSSPVLSELPRFQAARQALQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNESIRRLLKSELGSFITDYFQNQLLAKGLSFVEEKIKLCEGDNRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDVLLLAQSKLPSSVIQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLSISGDRSCSGPTYSLARRHSRVRPKVTVLNYASLMTTVGRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEAGGEDKHLLLPPSFPPPHRQCSSEPSILDSPDELELEDVASGSQEDSELNCASLS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/11753", 
                    "id": "11753", 
                    "database": "MGI"
                }
            ], 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073619.1", 
        "ac": "NP_001073619.1", 
        "name": "proline-rich protein 5-like; protein observed with Rictor-2.", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031932", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "TORC2 complex", 
                        "id": "GO:0031932"
                    }
                ], 
                "total": 1, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010762", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of fibroblast migration", 
                        "id": "GO:0010762"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090316", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of intracellular protein transport", 
                        "id": "GO:0090316"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001933", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of protein phosphorylation", 
                        "id": "GO:0001933"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cellular response to oxidative stress", 
                        "id": "GO:0034599"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009968", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of signal transduction", 
                        "id": "GO:0009968"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061014", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of mRNA catabolic process", 
                        "id": "GO:0061014"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038203", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1L1K1", 
                                "id": "A1L1K1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "TORC2 signaling", 
                        "id": "GO:0038203"
                    }
                ], 
                "total": 7, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 80, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 78
        }
    ], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073619.1", 
            "id": "NP_001073619.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:362171", 
            "id": "rno:362171", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013745", 
            "id": "IPR013745", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF08539", 
            "id": "PF08539", 
            "database": "Pfam"
        }, 
        {
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR32428", 
            "id": "PTHR32428", 
            "database": "PANTHER"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L1K1", 
            "id": "PR_A1L1K1", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/362171", 
            "id": "362171", 
            "database": "GeneID"
        }, 
        {
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1309969", 
            "id": "1309969", 
            "database": "RGD"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A1L1K1", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 41162.0, 
        "chemical_mass": 41162.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A1L1K1", 
            "name": "Prr5l; Protor2; Protor-2; RGD1309969.", 
            "locus": {
                "end_pos": 91291875, 
                "start_pos": 91370167, 
                "chromosome": "3", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOG00000004666", 
                        "id": "ENSRNOG00000004666", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}