{ "uniprot_canonical_ac": "A1E959-1", "sequence": { "header": "sp|A1E959-1|ODAM_HUMAN Isoform 1 of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 279, "sequence": "MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" }, "uniprot_id": "ODAM_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "odontogenic ameloblast-associated protein precursor", "odontogenic ameloblast-associated protein; odontogenic, ameloblast asssociated" ], "uniprotkb": [ "Odontogenic ameloblast-associated protein", "Apin" ] }, "gene": { "refseq": [ "ODAM", "APIN" ], "uniprotkb": [ "ODAM", "APIN" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Odontogenic ameloblast-associated protein; Apin." }, "publication": [ { "title": "The enamel protein ODAM promotes mineralization in a collagen matrix.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/29745811", "journal": "Connective tissue research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Ikeda Y, Neshatian M, Holcroft J, Ganss B", "date": "2018", "pmid": "29745811" }, { "title": "The clinical correlation of phosphatase and tensin homolog on chromosome 10, phosphorylation of AKT to an activated state, and odontogenic ameloblast-associated protein in gastrointestinal stromal tumors.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27229116", "journal": "The Journal of surgical research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "McLoughlin J, Nodit L, Heidel RE, Van Meter S, Macy S, Kestler D", "date": "2016", "pmid": "27229116" }, { "title": "Odontogenic ameloblast-associated protein (ODAM) inhibits human colorectal cancer growth by promoting PTEN elevation and inactivating PI3K/AKT signaling.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27694004", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Yu M, Mu Y, Qi Y, Qin S, Qiu Y, Cui R, Zhong M", "date": "2016", "pmid": "27694004" }, { "title": "ODAM inhibits RhoA-dependent invasion in breast cancer.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/26358398", "journal": "Cell biochemistry and function", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Lee HK, Choung HW, Yang YI, Yoon HJ, Park IA, Park JC", "date": "2015", "pmid": "26358398" }, { "title": "Odontogenic ameloblast-associated protein (ODAM) Mediates Junctional Epithelium Attachment to Tooth via Integrin-ODAM-Rho guanine nucleotide exchange factor 5 (ARHGEF5)-Ras homolog gene family member A (RhoA) Signaling.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/25911094", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959/publications", "id": "A1E959", "database": "UniProtKB" } ], "authors": "Park S.Y., Lee H.J., Choi Y., Choung H.W., Ji S., Lee H.K., Park J.C., Park S.J.", "date": "2015", "pmid": "25911094" }, { "title": "Characterization of Apin, a secreted protein highly expressed in tooth-associated epithelia.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17647262", "journal": "Journal of cellular biochemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1E959/publications", "id": "A1E959", "database": "UniProtKB" } ], "authors": "Moffatt P, Smith CE, St-Arnaud R, Nanci A", "date": "2008", "pmid": "17647262" }, { "title": "Expression of odontogenic ameloblast-associated protein (ODAM) in dental and other epithelial neoplasms.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18472969", "journal": "Molecular medicine (Cambridge, Mass.)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Kestler DP, Foster JS, Macy SD, Murphy CL, Weiss DT, Solomon A", "date": "2008", "pmid": "18472969" }, { "title": "Identification of secreted and membrane proteins in the rat incisor enamel organ using a signal-trap screening approach.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/16674676", "journal": "European journal of oral sciences", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Moffatt P, Smith CE, Sooknanan R, St-Arnaud R, Nanci A", "date": "2006", "pmid": "16674676" }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/16959974", "journal": "Science", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959/publications", "id": "A1E959", "database": "UniProtKB" } ], "authors": "Bachman K.E., Barber T.D., Buckhaults P., Dawson D., Farrell C., Gazdar A.F., Hartigan J., Jones S., Kinzler K.W., Leary R.J., Lin J., Liu C., Mandelker D., Markowitz S.D., Meeh P., Papadopoulos N., Park B.H., Parmigiani G., Parsons D.W., Ptak J., Silliman N., Sjoeblom T., Szabo S., Velculescu V.E., Vogelstein B., Willis J., Willson J.K.V., Wood L.D., Wu L.", "date": "2006", "pmid": "16959974" }, { "title": "Calcifying epithelial odontogenic (Pindborg) tumor-associated amyloid consists of a novel human protein.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/14647039", "journal": "The Journal of laboratory and clinical medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1E959/publications", "id": "A1E959", "database": "UniProtKB" } ], "authors": "Solomon A, Murphy CL, Weaver K, Weiss DT, Hrncic R, Eulitz M, Donnell RL, Sletten K, Westermark G, Westermark P", "date": "2003", "pmid": "14647039" } ], "glycosylation": [ { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 251, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 250, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 244, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 115, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 255, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Ser", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 256, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 263, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Ser", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 249, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 273, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 261, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Ser", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 275, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 119, "glytoucan_ac": "", "type": "O-linked" } ], "mutation": [ { "start_pos": 25, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "S", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "Y", "subjects_tested": "50", "end_pos": 25, "type": "Point mutation" }, { "start_pos": 102, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "frequency": "1.0", "annotation": "Filters passed (1/5): patient freq. (1.0%).", "sequence_org": "G", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "Urinary bladder cancer" }, "sequence_mut": "E", "subjects_tested": "103", "end_pos": 102, "type": "Point mutation" }, { "start_pos": 9, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "F", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "L", "subjects_tested": "50", "end_pos": 9, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1E959#A1E959-1", "isoform_ac": "A1E959-1", "locus": { "end_pos": 70196544, "start_pos": 70203182, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000396094", "id": "ENST00000396094", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000379401", "id": "ENSP00000379401", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1E959-1|ODAM_HUMAN Isoform 1 of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 279, "sequence": "MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" } }, { "url": "https://www.uniprot.org/uniprot/A1E959#H0YA46-1", "isoform_ac": "H0YA46-1", "locus": { "end_pos": 70197924, "start_pos": 70203182, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000514097", "id": "ENST00000514097", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000426106", "id": "ENSP00000426106", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|H0YA46-1|ODAM_HUMAN Computationally mapped isoform of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 216, "sequence": "GPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" } }, { "url": "https://www.uniprot.org/uniprot/A1E959#H0Y8T7-1", "isoform_ac": "H0Y8T7-1", "locus": { "end_pos": 70198122, "start_pos": 70200107, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000510847", "id": "ENST00000510847", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000422100", "id": "ENSP00000422100", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|H0Y8T7-1|ODAM_HUMAN Computationally mapped isoform of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 30, "sequence": "QTPPQTQPGPSHVMPYVFSFKMPQEQGQNI" } }, { "url": "https://www.uniprot.org/uniprot/A1E959#D6RA81-1", "isoform_ac": "D6RA81-1", "locus": { "end_pos": 70196544, "start_pos": 70202908, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000510709", "id": "ENST00000510709", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000423070", "id": "ENSP00000423070", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RA81-1|ODAM_HUMAN Computationally mapped isoform of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=2 CANONICAL=A1E959-1", "length": 253, "sequence": "MKIIILLGFLGATLSAPLLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELP" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:54959", "resource": "KEGG Pathway", "id": "hsa:54959", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "id": "R-HSA-977225", "name": "Amyloid fiber formation" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1E959#function", "annotation": "Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#function", "id": "A1E959", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Similar to AMTN, ODAM is able to promote HA nucleation in a dose-dependent manner in SBF, and even outside of its biological context in vitro.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "The inhibitory effects of ODAM on colorectal cancer cell growth were associated with PTEN elevation and PI3K/AKT signaling inactivation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Risk of recurrence correlated with cytoplasmic expression of ODAM and pAKT, whereas nuclear expression did not predict recurrence of gastrointestinal stromal tumors.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "ODAM induced RhoA activity. ODAM-mediated RhoA signalling resulted in actin filament rearrangement, increased cell adhesion and inhibited the migration/invasion of MCF7 cells. These results suggest that ODAM expression maintains their adhesion, resulting in the prevention of their metastasis via the regulation of RhoA signalling in breast cancer cells.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Data suggest that ODAM is a developmental antigen that has an essential role in tooth maturation and in the pathogenesis of certain odontogenic and other epithelial neoplasms", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "The protein sequences deduced from the cloned cDNA for rat, mouse, pig, and human were aligned together with those obtained from four other mammal genomes. Apin is highly conserved in mammals.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Calcifying epithelial odontogenic tumor-associated amyloid consists of a unique and previously undescribed protein that we provisionally designate APin.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A1E960-1", "protein_name": "Odontogenic ameloblast-associated protein; Apin.", "sequence": { "length": 273, "sequence": "MKIIILLGLIGASSSAPLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQQQQAQVSGRPQFTLSTLESFAGLFPNQIPLSRQVGLAQGGQAGQPDLSQQQTPPQTQQSASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQTVTSSPQHTGQQLFEEQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPTTSPKPSTDNFFTSGIDPTIAPEQKVKTDSLREP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/49511", "id": "49511", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q3HS83-1", "protein_name": "Odontogenic ameloblast-associated protein; Apin.", "sequence": { "length": 278, "sequence": "MKIIILLGLIGATSSAPLITQRLLSASNSHELLLNLNNGQLLPLQFQSAFNSWIPPFPGLLQQQQQQAQVSGHPQFPLSTLESFAGLFPNQIPFSRQVGFAQGGQAGQPDFSQQQTPSQTQQASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQQTVTSSPQQTGQQLYEEQIPFYNQFGFVPQQAEPGVPGGQQHLVLDSFVGTAPETPGMPAVEGPLYPQKEPIGFKQDNVGVSTPSTSPKPDTGNFFTSEINPTIAPLLPEQKVNADSLREP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/49511", "id": "49511", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "ac": "NP_060325.3", "name": "odontogenic ameloblast-associated protein precursor; odontogenic ameloblast-associated protein; odontogenic, ameloblast asssociated.", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099512", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "supramolecular fiber", "id": "GO:0099512" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "extracellular space", "id": "GO:0005615" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cell periphery", "id": "GO:0071944" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "extracellular region", "id": "GO:0005576" } ], "total": 6, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of protein phosphorylation", "id": "GO:0001934" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "inflammatory response", "id": "GO:0006954" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of gene expression", "id": "GO:0010628" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "regulation of actin cytoskeleton organization", "id": "GO:0032956" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of GTPase activity", "id": "GO:0043547" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060054", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of epithelial cell proliferation involved in wound healing", "id": "GO:0060054" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044267", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cellular protein metabolic process", "id": "GO:0044267" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031214", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "biomineral tissue development", "id": "GO:0031214" } ], "total": 9, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26043", "id": "26043", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A1E959", "id": "A1E959", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A1E959", "id": "NX_A1E959", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ODAM", "id": "ODAM", "database": "GeneCards" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "id": "R-HSA-977225", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:54959", "id": "hsa:54959", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/FPNQIPF/", "id": "FPNQIPF", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026802", "id": "IPR026802", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF15424", "id": "PF15424", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16237", "id": "PTHR16237", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1E959", "id": "PR_A1E959", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1E959*", "id": "A1E959", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/54959", "id": "54959", "database": "GeneID" } ], "expression_disease": [ { "trend": "Down", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] }, { "trend": "Down", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ] } ], "uniprot_ac": "A1E959", "disease": [], "mass": { "monoisotopic_mass": 30777.0, "chemical_mass": 30777.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "name": "ODAM; APIN.", "locus": { "end_pos": 70204576, "start_pos": 70196496, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000109205", "id": "ENSG00000109205", "database": "Ensembl Gene" } ] } } ] }