{
    "uniprot_canonical_ac": "A1E5L0-1", 
    "sequence": {
        "header": "tr|A1E5L0-1|A1E5L0_MOUSE Isoform 1 of Cytokine-like protein C17  OS=Mus musculus OX=10090 GN=Cytl1 PE=1 SV=1 CANONICAL=A1E5L0-1", 
        "length": 139, 
        "sequence": "MSPKTLPLLLLLVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS"
    }, 
    "uniprot_id": "A1E5L0_MOUSE", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "cytokine-like protein 1 precursor"
            ], 
            "uniprotkb": [
                "Cytokine-like protein C17", 
                "Cytokine-like 1"
            ]
        }, 
        "gene": {
            "refseq": [
                "Cytl1", 
                "4930443F05Rik", 
                "4Cytl1", 
                "C17", 
                "Cyt1", 
                "Gm147"
            ], 
            "uniprotkb": [
                "Cytl1", 
                "4Cytl1", 
                "4930443F05Rik", 
                "C17", 
                "Cyt1", 
                "Gm147"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                    "id": "A1E5L0", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "recommendedname": {
        "full": "Cytokine-like protein C17; Cytokine-like 1."
    }, 
    "publication": [
        {
            "title": "Cytokine-Like 1 Regulates Cardiac Fibrosis via Modulation of TGF-beta Signaling.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/27835665", 
            "journal": "PloS one", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Kim J, Kim J, Lee SH, Kepreotis SV, Yoo J, Chun JS, Hajjar RJ, Jeong D, Park WJ", 
            "date": "2016", 
            "pmid": "27835665"
        }, 
        {
            "title": "High-throughput screening of mouse gene knockouts identifies established and novel skeletal phenotypes.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/26273529", 
            "journal": "Bone research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Brommage R, Liu J, Hansen GM, Kirkpatrick LL, Potter DG, Sands AT, Zambrowicz B, Powell DR, Vogel P", 
            "date": "2014", 
            "pmid": "26273529"
        }, 
        {
            "title": "Differential gene expression of the intermediate and outer interzone layers of developing articular cartilage in murine embryos.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/24738827", 
            "journal": "Stem cells and development", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Jenner F, IJpma A, Cleary M, Heijsman D, Narcisi R, van der Spek PJ, Kremer A, van Weeren R, Brama P, van Osch GJ", 
            "date": "2014", 
            "pmid": "24738827"
        }, 
        {
            "title": "Cytokine-like 1 knock-out mice (Cytl1-/-) show normal cartilage and bone development but exhibit augmented osteoarthritic cartilage destruction.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/21652695", 
            "journal": "The Journal of biological chemistry", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Jeon J, Oh H, Lee G, Ryu JH, Rhee J, Kim JH, Chung KH, Song WK, Chun CH, Chun JS", 
            "date": "2011", 
            "pmid": "21652695"
        }, 
        {
            "title": "C17 prevents inflammatory arthritis and associated joint destruction in mice.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/21799806", 
            "journal": "PloS one", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Chao C, Joyce-Shaikh B, Grein J, Moshrefi M, Raoufi F, Laface DM, McClanahan TK, Bourne PA, Pierce RH, Gorman DM, Pflanz S", 
            "date": "2011", 
            "pmid": "21799806"
        }, 
        {
            "title": "Cytokine-like 1 (Cytl1) regulates the chondrogenesis of mesenchymal cells.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/17644814", 
            "journal": "The Journal of biological chemistry", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }, 
                {
                    "url": "https://www.uniprot.org/uniprot/A1E5L0/publications", 
                    "id": "A1E5L0", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Kim JS, Ryoo ZY, Chun JS", 
            "date": "2007", 
            "pmid": "17644814"
        }, 
        {
            "title": "Analysis of genes from inner ear developmental-stage cDNA subtraction reveals molecular regionalization of the otic capsule.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/15031101", 
            "journal": "Developmental biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Ficker M, Powles N, Warr N, Pirvola U, Maconochie M", 
            "date": "2004", 
            "pmid": "15031101"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A1E5L0#A1E5L0-1", 
            "isoform_ac": "A1E5L0-1", 
            "locus": {
                "end_pos": 37735548, 
                "start_pos": 37739292, 
                "chromosome": "5", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000073554", 
                        "id": "ENSMUST00000073554", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000073244", 
                        "id": "ENSMUSP00000073244", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A1E5L0-1|A1E5L0_MOUSE Isoform 1 of Cytokine-like protein C17  OS=Mus musculus OX=10090 GN=Cytl1 PE=1 SV=1 CANONICAL=A1E5L0-1", 
                "length": 139, 
                "sequence": "MSPKTLPLLLLLVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:231162", 
            "resource": "KEGG Pathway", 
            "id": "mmu:231162", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
            "annotation": "Collectively, the data suggest that Cytl1 plays an essential role in cardiac fibrosis likely through activating the TGF-beta-SMAD signaling pathway. Publication Status: Online-Only", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
            "annotation": "Results suggest that, rather than regulating cartilage and bone development, Cytl1 is required for the maintenance of cartilage homeostasis, and loss of Cytl1 function is associated with experimental OA cartilage destruction in mice", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
            "annotation": "C17 as a cytokine that s contributes to immune homeostasis systemically or in a tissue-specific manner in the joint", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
            "annotation": "Chondrocyte-specific Cytl1 regulates chondrogenesis as a novel autocrine factor, but not hypertrophic maturation of chondrocytes during cartilage development", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
                    "id": "NP_001074575.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "B5DFG7-1", 
            "protein_name": "Cytokine-like 1; Cytl1 protein.", 
            "sequence": {
                "length": 137, 
                "sequence": "MAPKTLPLLLSLLLVVWPLTVQPAPPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLYLDIHNYCVLTKLRDFVASPQCWKMAEVDMLKDRVRKLYTIMNSFCRRDLVFLSDDCSVLEHPIPETTDPPDWQS"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/10254", 
                    "id": "10254", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A1E5L0/", 
                    "id": "A1E5L0", 
                    "database": "OMA"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q9NRR1-1", 
            "protein_name": "Cytokine-like protein 1; Protein C17.", 
            "sequence": {
                "length": 136, 
                "sequence": "MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/10254", 
                    "id": "10254", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A1E5L0/", 
                    "id": "A1E5L0", 
                    "database": "OMA"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
        "ac": "NP_001074575.1", 
        "name": "cytokine-like protein 1 precursor.", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                                "id": "A1E5L0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of transcription by RNA polymerase II", 
                        "id": "GO:0045944"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                                "id": "A1E5L0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of DNA-binding transcription factor activity", 
                        "id": "GO:0051091"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002062", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                                "id": "A1E5L0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "chondrocyte differentiation", 
                        "id": "GO:0002062"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048839", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                                "id": "A1E5L0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "inner ear development", 
                        "id": "GO:0048839"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050650", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                                "id": "A1E5L0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "chondroitin sulfate proteoglycan biosynthetic process", 
                        "id": "GO:0050650"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990079", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A1E5L0", 
                                "id": "A1E5L0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cartilage homeostasis", 
                        "id": "GO:1990079"
                    }
                ], 
                "total": 6, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074575.1", 
            "id": "NP_001074575.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:231162", 
            "id": "mmu:231162", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000062329", 
            "id": "ENSMUSG00000062329", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/CYSRMLT/", 
            "id": "CYSRMLT", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029253", 
            "id": "IPR029253", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF15153", 
            "id": "PF15153", 
            "database": "Pfam"
        }, 
        {
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15974", 
            "id": "PTHR15974", 
            "database": "PANTHER"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/231162", 
            "id": "231162", 
            "database": "GeneID"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2684993", 
            "id": "2684993", 
            "database": "MGI"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A1E5L0", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 15854.0, 
        "chemical_mass": 15854.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A1E5L0", 
            "name": "Cytl1; 4Cytl1; 4930443F05Rik; C17; Cyt1; Gm147.", 
            "locus": {
                "end_pos": 37739820, 
                "start_pos": 37735519, 
                "chromosome": "5", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000062329", 
                        "id": "ENSMUSG00000062329", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}