{ "uniprot_canonical_ac": "A0JPP1-1", "sequence": { "header": "sp|A0JPP1-1|NC2A_RAT Isoform 1 of Dr1-associated corepressor OS=Rattus norvegicus OX=10116 GN=Drap1 PE=2 SV=1 CANONICAL=A0JPP1-1", "length": 205, "sequence": "MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHTDGDKGPRRGRKPGSSGRKNGGTGSKSKDKKLSGTDSEQEDESEDTDTDGEEETPQAPPQASHPPAHFQSPPTPFMPFTSPLPLPPAPPGPSAPEAEDEEDYDS" }, "uniprot_id": "NC2A_RAT", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "dr1-associated corepressor", "NC2-alpha; Dr1 associated protein 1 (negative cofactor 2 alpha); dr1-associated protein 1; negative co-factor 2-alpha; negative cofactor 2-alpha" ], "uniprotkb": [ "Dr1-associated corepressor", "Negative cofactor 2-alpha", "NC2-alpha", "Dr1-associated protein 1" ] }, "gene": { "refseq": [ "Drap1" ], "uniprotkb": [ "Drap1" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "id": "A0JPP1", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "recommendedname": { "full": "Dr1-associated corepressor; Negative cofactor 2-alpha; NC2-alpha; Dr1-associated protein 1." }, "publication": [ { "title": "Pooled-matrix protein interaction screens using Barcode Fusion Genetics.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/27107012", "journal": "Molecular systems biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071136.1", "id": "NP_001071136.1", "database": "RefSeq" } ], "authors": "Yachie N, Petsalaki E, Mellor JC, Weile J, Jacob Y, Verby M, Ozturk SB, Li S, Cote AG, Mosca R, Knapp JJ, Ko M, Yu A, Gebbia M, Sahni N, Yi S, Tyagi T, Sheykhkarimli D, Roth JF, Wong C, Musa L, Snider J, Liu YC, Yu H, Braun P, Stagljar I, Hao T, Calderwood MA, Pelletier L, Aloy P, Hill DE, Vidal M, Roth FP", "date": "2016", "pmid": "27107012" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1#A0JPP1-1", "isoform_ac": "A0JPP1-1", "locus": { "end_pos": 220804382, "start_pos": 220806228, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000038138", "id": "ENSRNOT00000038138", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000032674", "id": "ENSRNOP00000032674", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0JPP1-1|NC2A_RAT Isoform 1 of Dr1-associated corepressor OS=Rattus norvegicus OX=10116 GN=Drap1 PE=2 SV=1 CANONICAL=A0JPP1-1", "length": 205, "sequence": "MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHTDGDKGPRRGRKPGSSGRKNGGTGSKSKDKKLSGTDSEQEDESEDTDTDGEEETPQAPPQASHPPAHFQSPPTPFMPFTSPLPLPPAPPGPSAPEAEDEEDYDS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?rno:293674", "resource": "KEGG Pathway", "id": "rno:293674", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1181150", "resource": "Reactome", "id": "R-RNO-1181150", "name": "Signaling by NODAL" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1502540", "resource": "Reactome", "id": "R-RNO-1502540", "name": "Signaling by Activin" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1#function", "annotation": "The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1#function", "id": "A0JPP1", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q9D6N5-1", "protein_name": "Dr1-associated corepressor; Negative cofactor 2-alpha; NC2-alpha; Dr1-associated protein 1.", "sequence": { "length": 205, "sequence": "MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHVDGDKGPRRGRKPGSSGRKNGGTGSKGKDKKLSGTDSEQEDESEDTDTDGEEETPQLPPQASHPPAHFQSPPTPFIPFTSPLPLPPAPPGPSAADAEDEEDYDS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/4703", "id": "4703", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A0JPP1/", "id": "A0JPP1", "database": "OMA" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q14919-1", "protein_name": "Dr1-associated corepressor; Negative cofactor 2-alpha; NC2-alpha; Dr1-associated protein 1.", "sequence": { "length": 205, "sequence": "MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/4703", "id": "4703", "database": "MGI" } ], "organism": "Homo sapiens", "tax_id": 9606 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071136.1", "ac": "NP_001071136.1", "name": "dr1-associated corepressor; NC2-alpha; Dr1 associated protein 1 (negative cofactor 2 alpha); dr1-associated protein 1; negative co-factor 2-alpha; negative cofactor 2-alpha.", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003712", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "id": "A0JPP1", "database": "UniProtKB" } ], "name": "transcription coregulator activity", "id": "GO:0003712" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "id": "A0JPP1", "database": "UniProtKB" } ], "name": "DNA binding", "id": "GO:0003677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "id": "A0JPP1", "database": "UniProtKB" } ], "name": "identical protein binding", "id": "GO:0042802" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "id": "A0JPP1", "database": "UniProtKB" } ], "name": "protein heterodimerization activity", "id": "GO:0046982" } ], "total": 4, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "id": "A0JPP1", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" } ], "total": 1, "name": "Cellular Component" } ] }, "site_annotation": [ { "end_pos": 102, "annotation": "n_glycosylation_sequon", "start_pos": 100 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071136.1", "id": "NP_001071136.1", "database": "RefSeq" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1181150", "id": "R-RNO-1181150", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1502540", "id": "R-RNO-1502540", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?rno:293674", "id": "rno:293674", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000020527", "id": "ENSRNOG00000020527", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/PHKDEND/", "id": "PHKDEND", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003958", "id": "IPR003958", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "id": "IPR009072", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF00808", "id": "PF00808", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0JPP1", "id": "PR_A0JPP1", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/293674", "id": "293674", "database": "GeneID" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308477", "id": "1308477", "database": "RGD" } ], "expression_disease": [], "uniprot_ac": "A0JPP1", "disease": [], "mass": { "monoisotopic_mass": 22326.0, "chemical_mass": 22326.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0JPP1", "name": "Drap1.", "locus": { "end_pos": 220803796, "start_pos": 220806433, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000020527", "id": "ENSRNOG00000020527", "database": "Ensembl Gene" } ] } } ] }