{
    "uniprot_canonical_ac": "A0JPK3-1", 
    "sequence": {
        "header": "sp|A0JPK3-1|ZFP57_RAT Isoform 1 of Zinc finger protein 57  OS=Rattus norvegicus OX=10116 GN=Zfp57 PE=2 SV=1 CANONICAL=A0JPK3-1", 
        "length": 406, 
        "sequence": "MAAKKQSKSAKALRTTVRYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVESKKKPQEPNPNLKDKDDDKSSTCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTKPQSRKALGHKPQHRGDRPFFCNLCGKTYRDASGLSRHRRAHVGYRPRSCPECGKCFRDQSEVNRHLKVHQNKKPVAGSHVKVHQNKPVASNQKQKGRVPPTTRESPAPALRHLKVIQGPVARAKARSSRASSLEVRSTSVTVARPREKVYCPYCRITFTMRTCLLNHLKIHFRRQPNQHFCCKESHSSNTLRMQKIYNCPVCDSSFRGKESLLNHLCSRRPIRLSKCWEILGHLLGYLREPLGNIFKVRESRKRRRKRISSDSSETEGPSGSDEVMEVDTDSDLS"
    }, 
    "uniprot_id": "ZFP57_RAT", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "zinc finger protein 57", 
                "zfp-57"
            ], 
            "uniprotkb": [
                "Zinc finger protein 57", 
                "Zfp-57"
            ]
        }, 
        "gene": {
            "refseq": [
                "Zfp57"
            ], 
            "uniprotkb": [
                "Zfp57"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                    "id": "A0JPK3", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Rattus norvegicus", 
            "taxid": 10116
        }
    ], 
    "recommendedname": {
        "full": "Zinc finger protein 57; Zfp-57.", 
        "short": "Zfp-57"
    }, 
    "publication": [
        {
            "title": "Hsp72 preserves muscle function and slows progression of severe muscular dystrophy.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/22495301", 
            "journal": "Nature", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", 
                    "id": "NP_998730.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Gehrig SM, van der Poel C, Sayer TA, Schertzer JD, Henstridge DC, Church JE, Lamon S, Russell AP, Davies KE, Febbraio MA, Lynch GS", 
            "date": "2012", 
            "pmid": "22495301"
        }, 
        {
            "title": "Hypomethylation of multiple imprinted loci in individuals with transient neonatal diabetes is associated with mutations in ZFP57.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/18622393", 
            "journal": "Nature genetics", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", 
                    "id": "NP_998730.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Mackay DJ, Callaway JL, Marks SM, White HE, Acerini CL, Boonen SE, Dayanikli P, Firth HV, Goodship JA, Haemers AP, Hahnemann JM, Kordonouri O, Masoud AF, Oestergaard E, Storr J, Ellard S, Hattersley AT, Robinson DO, Temple IK", 
            "date": "2008", 
            "pmid": "18622393"
        }, 
        {
            "title": "A maternal-zygotic effect gene, Zfp57, maintains both maternal and paternal imprints.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/18854139", 
            "journal": "Developmental cell", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", 
                    "id": "NP_998730.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Li X, Ito M, Zhou F, Youngson N, Zuo X, Leder P, Ferguson-Smith AC", 
            "date": "2008", 
            "pmid": "18854139"
        }, 
        {
            "title": "The genomic sequence and comparative analysis of the rat major histocompatibility complex.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/15060004", 
            "journal": "Genome Res.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPK3/publications", 
                    "id": "A0JPK3", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Klages S., Lehrach H., Mueller I., Reinhardt R., Sudbrak R., Inoko H., Shiina T., Guenther E., Walter L., Himmelbauer H., Hurt P.", 
            "date": "2004", 
            "pmid": "15060004"
        }, 
        {
            "title": "Identification and characterization of ZFP-57, a novel zinc finger transcription factor in the mammalian peripheral nervous system.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/15070898", 
            "journal": "The Journal of biological chemistry", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", 
                    "id": "NP_998730.2", 
                    "database": "RefSeq"
                }, 
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPK3/publications", 
                    "id": "A0JPK3", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Alonso MB, Zoidl G, Taveggia C, Bosse F, Zoidl C, Rahman M, Parmantier E, Dean CH, Harris BS, Wrabetz L, Muller HW, Jessen KR, Mirsky R", 
            "date": "2004", 
            "pmid": "15070898"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPK3#A0JPK3-1", 
            "isoform_ac": "A0JPK3-1", 
            "locus": {
                "end_pos": 2014535, 
                "start_pos": 2018285, 
                "chromosome": "20", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000011704", 
                        "id": "ENSRNOT00000011704", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000011704", 
                        "id": "ENSRNOP00000011704", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A0JPK3-1|ZFP57_RAT Isoform 1 of Zinc finger protein 57  OS=Rattus norvegicus OX=10116 GN=Zfp57 PE=2 SV=1 CANONICAL=A0JPK3-1", 
                "length": 406, 
                "sequence": "MAAKKQSKSAKALRTTVRYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVESKKKPQEPNPNLKDKDDDKSSTCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTKPQSRKALGHKPQHRGDRPFFCNLCGKTYRDASGLSRHRRAHVGYRPRSCPECGKCFRDQSEVNRHLKVHQNKKPVAGSHVKVHQNKPVASNQKQKGRVPPTTRESPAPALRHLKVIQGPVARAKARSSRASSLEVRSTSVTVARPREKVYCPYCRITFTMRTCLLNHLKIHFRRQPNQHFCCKESHSSNTLRMQKIYNCPVCDSSFRGKESLLNHLCSRRPIRLSKCWEILGHLLGYLREPLGNIFKVRESRKRRRKRISSDSSETEGPSGSDEVMEVDTDSDLS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:361783", 
            "resource": "KEGG Pathway", 
            "id": "rno:361783", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPK3#function", 
            "annotation": "Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions (ICRs). Acts together with ZNF445. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells. Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPK3#function", 
                    "id": "A0JPK3", 
                    "database": "UniProtKB"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q9NU63-1", 
            "protein_name": "Zinc finger protein 57 homolog; Zfp-57; Zinc finger protein 698.", 
            "sequence": {
                "length": 452, 
                "sequence": "MAAGEPRSLLFFQKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWRETRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/7603", 
                    "id": "7603", 
                    "database": "MGI"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }, 
        {
            "uniprot_canonical_ac": "Q8C6P8-1", 
            "protein_name": "Zinc finger protein 57; Zfp-57.", 
            "sequence": {
                "length": 421, 
                "sequence": "MAARKQSSQPSRTPVSYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVGSKKKPQEPSSDLQDKNEEQEKSSSCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTNPQSRKGKGYKAQHRGERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKPAASNQAGNQASNQRLKSRVPPTTPRSQAPALKYVKVIQGPVARAKARNSGASTLNVRSNSITVVRSREKISCPYCHITFTMRTCLLTHLKIHFRRQPNQHFCCKESAHSSNTLRMQKIYTCPVCDSSFRGKESLLDHLCCQRPIRFSKCWEILGHLLGYLHEPVVLGNIFKVRDSSGKRMESRRRRRKRACTENPETEGLSGKGRVAPWEMEGATSPESPVTEEDSD"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/7603", 
                    "id": "7603", 
                    "database": "MGI"
                }
            ], 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", 
        "ac": "NP_998730.2", 
        "name": "zinc finger protein 57; zfp-57.", 
        "summary": "has transcriptional repressor activity in Schwann cells; may play a role in early stages of Schwann cell development [RGD, Feb 2006]."
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                                "id": "A0JPK3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "DNA binding", 
                        "id": "GO:0003677"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                                "id": "A0JPK3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "metal ion binding", 
                        "id": "GO:0046872"
                    }
                ], 
                "total": 2, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                                "id": "A0JPK3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleus", 
                        "id": "GO:0005634"
                    }
                ], 
                "total": 1, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043045", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                                "id": "A0JPK3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "DNA methylation involved in embryo development", 
                        "id": "GO:0043045"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                                "id": "A0JPK3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of transcription, DNA-templated", 
                        "id": "GO:0006355"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006349", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPK3", 
                                "id": "A0JPK3", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of gene expression by genetic imprinting", 
                        "id": "GO:0006349"
                    }
                ], 
                "total": 3, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 54, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 52
        }
    ], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", 
            "id": "NP_998730.2", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:361783", 
            "id": "rno:361783", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000022730", 
            "id": "ENSRNOG00000022730", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/CGKLFWS/", 
            "id": "CGKLFWS", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07765", 
            "id": "cd07765", 
            "database": "CDD"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", 
            "id": "IPR013087", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", 
            "id": "IPR036236", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", 
            "id": "IPR001909", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", 
            "id": "IPR036051", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF01352", 
            "id": "PF01352", 
            "database": "Pfam"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF00096", 
            "id": "PF00096", 
            "database": "Pfam"
        }, 
        {
            "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0JPK3", 
            "id": "PR_A0JPK3", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/361783", 
            "id": "361783", 
            "database": "GeneID"
        }, 
        {
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1302981", 
            "id": "1302981", 
            "database": "RGD"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A0JPK3", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 46588.0, 
        "chemical_mass": 46588.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPK3", 
            "name": "Zfp57.", 
            "locus": {
                "end_pos": 2014170, 
                "start_pos": 2020537, 
                "chromosome": "20", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOG00000022730", 
                        "id": "ENSRNOG00000022730", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}