{ "uniprot_canonical_ac": "A0AVK6-1", "sequence": { "header": "sp|A0AVK6-1|E2F8_HUMAN Isoform 1 of Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1 CANONICAL=A0AVK6-1", "length": 867, "sequence": "MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPTANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEISPNTSGSSPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIKTNKAESSQNSAPFPSKMAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSSKATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAGERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGAESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKLMVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNFTLQHLGLISPNVQLSASPGSGIVPVSPRIESVNVAPENAGTQQGRATNYDSPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH" }, "uniprot_id": "E2F8_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "transcription factor E2F8", "E2F family member 8" ], "uniprotkb": [ "Transcription factor E2F8", "E2F-8" ] }, "gene": { "refseq": [ "E2F8", "E2F-8" ], "uniprotkb": [ "E2F8", "E2F-8" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Transcription factor E2F8; E2F-8.", "short": "E2F-8" }, "publication": [ { "title": "miR-223-5p Suppresses Tumor Growth and Metastasis in Non-Small Cell Lung Cancer by Targeting E2F8.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/29615147", "journal": "Oncology research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ], "authors": "Dou L, Han K, Xiao M, Lv F", "date": "2019", "pmid": "29615147" }, { "title": "Hsa_circ_0002468 Regulates the Neuronal Differentiation of SH-SY5Y Cells by Modulating the MiR-561/E2F8 Axis.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/30951518", "journal": "Medical science monitor : international medical journal of experimental and clinical research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ], "authors": "Yang M, Xiang G, Yu D, Yang G, He W, Yang S, Zhou G, Liu A", "date": "2019", "pmid": "30951518" }, { "title": "Upregulated miR-1258 regulates cell cycle and inhibits cell proliferation by directly targeting E2F8 in CRC.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/30144184", "journal": "Cell proliferation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ], "authors": "Zhang Z, Li J, Huang Y, Peng W, Qian W, Gu J, Wang Q, Hu T, Ji D, Ji B, Zhang Y, Wang S, Sun Y", "date": "2018", "pmid": "30144184" }, { "title": "E2F8 confers cisplatin resistance to ER+ breast cancer cells via transcriptionally activating MASTL.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/28605876", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ], "authors": "Tian J, Lin Y, Yu J", "date": "2017", "pmid": "28605876" }, { "title": "E2F8, a direct target of miR-144, promotes papillary thyroid cancer progression via regulating cell cycle.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/28270228", "journal": "Journal of experimental & clinical cancer research : CR", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ], "authors": "Sun J, Shi R, Zhao S, Li X, Lu S, Bu H, Ma X, Su C", "date": "2017", "pmid": "28270228" }, { "title": "E2F7 and E2F8 promote angiogenesis through transcriptional activation of VEGFA in cooperation with HIF1.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22903062", "journal": "EMBO J.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Leone G., Schulte-Merker S., Bakker W.J., Cornelissen P.W., Kent L., Liang K.H., Paciejewska M., Schaftenaar F.H., Scheele C.L., Weijts B.G., Westendorp B., de Bruin A., de Wolf C.A.", "date": "2012", "pmid": "22903062" }, { "title": "E2F7, a novel target, is up-regulated by p53 and mediates DNA damage-dependent transcriptional repression.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22802528", "journal": "Genes Dev.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Hamard P.J., Carvajal L.A., Manfredi J.J., Tonnessen C.", "date": "2012", "pmid": "22802528" }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18220336", "journal": "J. Proteome Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Cantin G.T., Lee J.-D., Lu B., Park S.K., Xu T., Yates J.R. III, Yi W., Yates J.R., Lee J.D.", "date": "2008", "pmid": "18220336" }, { "title": "DNA-damage response control of E2F7 and E2F8.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18202719", "journal": "EMBO reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Zalmas LP, Zhao X, Graham AL, Fisher R, Reilly C, Coutts AS, La Thangue NB", "date": "2008", "pmid": "18202719" }, { "title": "Synergistic function of E2F7 and E2F8 is essential for cell survival and embryonic development.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18194653", "journal": "Dev. Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Li J., Li E., Weinstein M., Leone G., Liu C.-G., Chen H.-Z., Cleghorn W., Comstock G., Gordon F., Khanizadeh M., Kornacker K., Pandit S.K., Ran C., Siddiqui H., de Bruin A.", "date": "2008", "pmid": "18194653" }, { "title": "Characterization of E2F8, a novel E2F-like cell-cycle regulated repressor of E2F-activated transcription.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/16179649", "journal": "Nucleic acids research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Christensen J, Cloos P, Toftegaard U, Klinkenberg D, Bracken AP, Trinh E, Heeran M, Di Stefano L, Helin K", "date": "2005", "pmid": "16179649" }, { "title": "Cloning and characterization of mouse E2F8, a novel mammalian E2F family member capable of blocking cellular proliferation.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/15722552", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ], "authors": "Maiti B, Li J, de Bruin A, Gordon F, Timmers C, Opavsky R, Patil K, Tuttle J, Cleghorn W, Leone G", "date": "2005", "pmid": "15722552" }, { "title": "E2F-8: an E2F family member with a similar organization of DNA-binding domains to E2F-7.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/15897886", "journal": "Oncogene", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A0AVK6/publications", "id": "A0AVK6", "database": "UniProtKB" } ], "authors": "Logan N, Graham A, Zhao X, Fisher R, Maiti B, Leone G, La Thangue NB", "date": "2005", "pmid": "15897886" } ], "glycosylation": [], "mutation": [ { "start_pos": 56, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.1", "annotation": "Filters passed (1/5): num. of cancers (3).", "sequence_org": "P", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "Urinary bladder cancer" }, "sequence_mut": "L", "subjects_tested": "742", "end_pos": 56, "type": "Point mutation" }, { "start_pos": 159, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.1", "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs751632122.", "sequence_org": "D", "disease": { "doid": "1319", "url": "http://disease-ontology.org/term/DOID:1319", "icd10": "", "name": "Brain cancer" }, "sequence_mut": "N", "subjects_tested": "678", "end_pos": 159, "type": "Point mutation" }, { "start_pos": 281, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.2", "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs755274793.", "sequence_org": "T", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "M", "subjects_tested": "456", "end_pos": 281, "type": "Point mutation" }, { "start_pos": 803, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "T", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "I", "subjects_tested": "50", "end_pos": 803, "type": "Point mutation" }, { "start_pos": 281, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.9", "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs755274793.", "sequence_org": "T", "disease": { "doid": "363", "url": "http://disease-ontology.org/term/DOID:363", "icd10": "", "name": "Uterine cancer" }, "sequence_mut": "M", "subjects_tested": "114", "end_pos": 281, "type": "Point mutation" }, { "start_pos": 56, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.2", "annotation": "Filters passed (1/5): num. of cancers (3).", "sequence_org": "P", "disease": { "doid": "363", "url": "http://disease-ontology.org/term/DOID:363", "icd10": "", "name": "Uterine cancer" }, "sequence_mut": "L", "subjects_tested": "558", "end_pos": 56, "type": "Point mutation" }, { "start_pos": 821, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "E", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "*", "subjects_tested": "50", "end_pos": 821, "type": "Point mutation" }, { "start_pos": 56, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.1", "annotation": "Filters passed (1/5): num. of cancers (3).", "sequence_org": "P", "disease": { "doid": "10534", "url": "http://disease-ontology.org/term/DOID:10534", "icd10": "", "name": "Stomach cancer" }, "sequence_mut": "L", "subjects_tested": "1044", "end_pos": 56, "type": "Point mutation" }, { "start_pos": 159, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.2", "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs751632122.", "sequence_org": "D", "disease": { "doid": "363", "url": "http://disease-ontology.org/term/DOID:363", "icd10": "", "name": "Uterine cancer" }, "sequence_mut": "N", "subjects_tested": "558", "end_pos": 159, "type": "Point mutation" }, { "start_pos": 159, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.1", "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs751632122.", "sequence_org": "D", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "Urinary bladder cancer" }, "sequence_mut": "N", "subjects_tested": "742", "end_pos": 159, "type": "Point mutation" }, { "start_pos": 281, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0AVK6", "id": "A0AVK6", "database": "BioMuta" } ], "frequency": "0.1", "annotation": "Filters passed (1/5): num. of cancers (3). In dbSNP: rs755274793.", "sequence_org": "T", "disease": { "doid": "10534", "url": "http://disease-ontology.org/term/DOID:10534", "icd10": "", "name": "Stomach cancer" }, "sequence_mut": "M", "subjects_tested": "1044", "end_pos": 281, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6#A0AVK6-1", "isoform_ac": "A0AVK6-1", "locus": { "end_pos": 19224661, "start_pos": 19240121, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000620009", "id": "ENST00000620009", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000481103", "id": "ENSP00000481103", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0AVK6-1|E2F8_HUMAN Isoform 1 of Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1 CANONICAL=A0AVK6-1", "length": 867, "sequence": "MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPTANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGHPDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEISPNTSGSSPVIHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIKTNKAESSQNSAPFPSKMAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSSKATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAGERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGAESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKLMVSPTSVAAVPVGNSPALASSHPVPIQNPSSAIVNFTLQHLGLISPNVQLSASPGSGIVPVSPRIESVNVAPENAGTQQGRATNYDSPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH" } }, { "url": "https://www.uniprot.org/uniprot/A0AVK6#E9PMT9-1", "isoform_ac": "E9PMT9-1", "locus": { "end_pos": 19237348, "start_pos": 19240121, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000532666", "id": "ENST00000532666", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000437326", "id": "ENSP00000437326", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9PMT9-1|E2F8_HUMAN Computationally mapped isoform of Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1 CANONICAL=A0AVK6-1", "length": 139, "sequence": "MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPTANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGLLCHKFLARYPNYPNPAVNN" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:79733", "resource": "KEGG Pathway", "id": "hsa:79733", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116", "resource": "Reactome", "id": "R-HSA-6804116", "name": "TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6#function", "annotation": "Atypical E2F transcription factor that participates in various processes such as angiogenesis and polyploidization of specialized cells. Mainly acts as a transcription repressor that binds DNA independently of DP proteins and specifically recognizes the E2 recognition site 5'-TTTC[CG]CGC-3'. Directly represses transcription of classical E2F transcription factors such as E2F1: component of a feedback loop in S phase by repressing the expression of E2F1, thereby preventing p53/TP53-dependent apoptosis. Plays a key role in polyploidization of cells in placenta and liver by regulating the endocycle, probably by repressing genes promoting cytokinesis and antagonizing action of classical E2F proteins (E2F1, E2F2 and/or E2F3). Required for placental development by promoting polyploidization of trophoblast giant cells. Acts as a promoter of sprouting angiogenesis, possibly by acting as a transcription activator: associates with HIF1A, recognizes and binds the VEGFA promoter, which is different from canonical E2 recognition site, and activates expression of the VEGFA gene.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6#function", "id": "A0AVK6", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "Authors detected the expression of hsa_circ_0002468, miR-561, and E2F8 by using quantitative real-time polymerase chain reaction (qRT-PCR) analyses. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "MiR-223-5p suppressed NSCLC progression through targeting E2F8.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "MiR-1258 may function as a suppressive factor by negatively controlling E2F8", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "E2F8 can shorten cisplatin induced G2/M arrest by promoting MASTL mediated mitotic progression in ER+ breast cancer cells, conferring drug resistance.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "Study provides evidence that E2F8 functions as a proliferation-related oncogene in papillary thyroid cancer progression. Moreover, miR-144 appears to be a tumor suppressor through direct inhibition of E2F8. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "E2F7 and E2F8 act upstream of E2F1, and influence the ability of cells to undergo a DNA-damage response.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "E2F8 may have an important role in repressing the expression of E2F-target genes in the S-phase of the cell cycle. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "annotation": "The similarities between E2F-7 and E2F-8 define a new subgroup of the E2F family, and further imply that E2F-7 and E2F-8 may act through overlapping mechanisms in mediating cell cycle control.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q58FA4-1", "protein_name": "Transcription factor E2F8; E2F-8.", "sequence": { "length": 860, "sequence": "MENQKENLFSEPHKRGLMKSPLHPSSKANMVLAEIQPDLGPLTTPTKPKEVSQGEPWTPTANLKMLISAVSPEIRSRDQKRGLSDNRSALPEARDCLHEHLSGDEFEKSQPSRKEKSLGLLCHKFLARYPKYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLTKTLGTLKSVGEENKYAEQIMMIKRKEYEQEFDFIKSCGIEDHVIKSHTGQNGHSDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEIAAKILIGEDHVEDLDKSKYKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEISPNNSGSSPIMPLPASLEAEQSAKENCAKNLFSTRGKPSFTRHPSLIKLVKSIENDRRKISSAPSSPVKSNKAESSQNSPPVPNKMAQLAAICKMQLEEQSSEPRKKVKVNLARSGHYKPLAPLDPTVNTELELLTPSLIQPLGVVPLIPSPLSSAVPVILPQAPSGPSYAIYLQPAQAQMLTPPPGLSPTVCPTQPSNATGSKDPTDAPAEKTATDAATTGSLQPAPERHGAKHRSKETTGDRGTKRMITAEDSGPSSVKKPKEDLKALENVPTPTPLFPSGYLIPLTQCSSLGPDSVLSNTENSGTPSPNHRIYGSPIAGVIPVASSELTAVNFPPFHVTPLKLMVSPTSMAAVPVGNSPALNSGHPAPAQNPSSAIVNFTLQHLGLISPGVQMSASPGPGAGTVPVSPRVEADNLSSRQRRATNHDSPVLGQSQLNGQPVAGTGAQQPVPVTPKGSQLVAENFFRTPGGPTKPTSSPYTDFDGANKTSFGTLFVPQRKLEVSTEDIH" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/11654", "id": "11654", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "ac": "NP_001243300.1", "name": "transcription factor E2F8; E2F family member 8.", "summary": "This gene encodes a member of a family of transcription factors which regulate the expression of genes required for progression through the cell cycle. The encoded protein regulates progression from G1 to S phase by ensuring the nucleus divides at the proper time. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2012]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "DNA binding", "id": "GO:0003677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "DNA-binding transcription factor activity", "id": "GO:0003700" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008134", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "transcription factor binding", "id": "GO:0008134" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "RNA polymerase II proximal promoter sequence-specific DNA binding", "id": "GO:0000978" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000987", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "proximal promoter sequence-specific DNA binding", "id": "GO:0000987" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "sequence-specific DNA binding", "id": "GO:0043565" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "protein homodimerization activity", "id": "GO:0042803" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "transcription corepressor activity", "id": "GO:0003714" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981" } ], "total": 10, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "RNA polymerase II transcription factor complex", "id": "GO:0090575" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000790", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "nuclear chromatin", "id": "GO:0000790" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "nucleolus", "id": "GO:0005730" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" } ], "total": 6, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002040", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "sprouting angiogenesis", "id": "GO:0002040" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051726", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "regulation of cell cycle", "id": "GO:0051726" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032877", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "positive regulation of DNA endoreduplication", "id": "GO:0032877" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033301", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "cell cycle comprising mitosis without cytokinesis", "id": "GO:0033301" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060718", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "chorionic trophoblast cell differentiation", "id": "GO:0060718" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008283", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "cell population proliferation", "id": "GO:0008283" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001890", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "placenta development", "id": "GO:0001890" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006977", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest", "id": "GO:0006977" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032466", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "negative regulation of cytokinesis", "id": "GO:0032466" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070365", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "hepatocyte differentiation", "id": "GO:0070365" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060707", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "id": "A0AVK6", "database": "UniProtKB" } ], "name": "trophoblast giant cell differentiation", "id": "GO:0060707" } ], "total": 13, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 88, "annotation": "n_glycosylation_sequon", "start_pos": 86 }, { "end_pos": 189, "annotation": "n_glycosylation_sequon", "start_pos": 187 }, { "end_pos": 355, "annotation": "n_glycosylation_sequon", "start_pos": 353 }, { "end_pos": 392, "annotation": "n_glycosylation_sequon", "start_pos": 390 }, { "end_pos": 570, "annotation": "n_glycosylation_sequon", "start_pos": 568 }, { "end_pos": 630, "annotation": "n_glycosylation_sequon", "start_pos": 628 }, { "end_pos": 661, "annotation": "n_glycosylation_sequon", "start_pos": 659 }, { "end_pos": 737, "annotation": "n_glycosylation_sequon", "start_pos": 735 }, { "end_pos": 847, "annotation": "n_glycosylation_sequon", "start_pos": 845 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243300.1", "id": "NP_001243300.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=24727", "id": "24727", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A0AVK6", "id": "A0AVK6", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A0AVK6", "id": "NX_A0AVK6", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=E2F8", "id": "E2F8", "database": "GeneCards" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804116", "id": "R-HSA-6804116", "database": "Reactome" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:79733", "id": "hsa:79733", "database": "KEGG Pathway" }, { "url": "https://www.rcsb.org/structure/4YO2", "id": "4YO2", "database": "PDB" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/PNGHPDM/", "id": "PNGHPDM", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "id": "IPR036388", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "id": "IPR036390", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR015633", "id": "IPR015633", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003316", "id": "IPR003316", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF02319", "id": "PF02319", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12081", "id": "PTHR12081", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0AVK6", "id": "PR_A0AVK6", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A0AVK6*", "id": "A0AVK6", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/79733", "id": "79733", "database": "GeneID" } ], "expression_disease": [ { "trend": "Up", "disease": { "doid": "5041", "url": "http://disease-ontology.org/term/DOID:5041", "icd10": "", "name": "DOID:5041 / Esophageal cancer [EC]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3907", "url": "http://disease-ontology.org/term/DOID:3907", "icd10": "", "name": "DOID:3907 / Lung squamous cell carcinoma" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3910", "url": "http://disease-ontology.org/term/DOID:3910", "icd10": "", "name": "DOID:3910 / Lung adenocarcinoma" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "DOID:3571 / Liver cancer [Livca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "10283", "url": "http://disease-ontology.org/term/DOID:10283", "icd10": "", "name": "DOID:10283 / Prostate cancer [PCa]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "11054", "url": "http://disease-ontology.org/term/DOID:11054", "icd10": "", "name": "DOID:11054 / Urinary bladder cancer [UBC]" }, "significant": "Yes", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] }, { "trend": "Up", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "DOID:1781 / Thyroid cancer [Thyca]" }, "significant": "No", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A0AVK6", "id": "A0AVK6", "database": "BioXpress" } ] } ], "uniprot_ac": "A0AVK6", "disease": [], "mass": { "monoisotopic_mass": 94166.0, "chemical_mass": 94166.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129173", "id": "ENSG00000129173", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0AVK6", "name": "E2F8; E2F-8.", "locus": { "end_pos": 19224063, "start_pos": 19241620, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000129173", "id": "ENSG00000129173", "database": "Ensembl Gene" } ] } } ] }