{
    "uniprot_canonical_ac": "A0A286YFK9-1", 
    "sequence": {
        "header": "sp|A0A286YFK9-1|SIM38_HUMAN Isoform 1 of Small integral membrane protein 38  OS=Homo sapiens OX=9606 GN=SMIM38 PE=3 SV=1 CANONICAL=A0A286YFK9-1", 
        "length": 51, 
        "sequence": "MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD"
    }, 
    "uniprot_id": "SIM38_HUMAN", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [], 
            "uniprotkb": [
                "Small integral membrane protein 38"
            ]
        }, 
        "gene": {
            "refseq": [], 
            "uniprotkb": [
                "SMIM38"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A286YFK9", 
                    "id": "A0A286YFK9", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Homo sapiens", 
            "taxid": 9606
        }
    ], 
    "recommendedname": {
        "full": "Small integral membrane protein 38."
    }, 
    "publication": [], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A286YFK9#A0A286YFK9-1", 
            "isoform_ac": "A0A286YFK9-1", 
            "locus": {
                "end_pos": 69159752, 
                "start_pos": 69160119, 
                "chromosome": "11", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENST00000641568", 
                        "id": "ENST00000641568", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSP00000493332", 
                        "id": "ENSP00000493332", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A0A286YFK9-1|SIM38_HUMAN Isoform 1 of Small integral membrane protein 38  OS=Homo sapiens OX=9606 GN=SMIM38 PE=3 SV=1 CANONICAL=A0A286YFK9-1", 
                "length": 51, 
                "sequence": "MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD"
            }
        }
    ], 
    "pathway": [], 
    "function": [], 
    "orthologs": [], 
    "refseq": {
        "url": "", 
        "ac": "", 
        "name": "", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A286YFK9", 
                                "id": "A0A286YFK9", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "integral component of membrane", 
                        "id": "GO:0016021"
                    }
                ], 
                "total": 1, 
                "name": "Cellular Component"
            }
        ]
    }, 
    "site_annotation": [], 
    "crossref": [
        {
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=54074", 
            "id": "54074", 
            "database": "HGNC"
        }, 
        {
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SMIM38", 
            "id": "SMIM38", 
            "database": "GeneCards"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A0A286YFK9", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 5769.0, 
        "chemical_mass": 5769.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A286YFK9", 
            "name": "SMIM38.", 
            "locus": {
                "end_pos": 69159752, 
                "start_pos": 69155478, 
                "chromosome": "11", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSG00000284713", 
                        "id": "ENSG00000284713", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}