{
    "uniprot_canonical_ac": "A0A1L1STR8-1", 
    "sequence": {
        "header": "tr|A0A1L1STR8-1|A0A1L1STR8_MOUSE Isoform 1 of Neuropeptide W  OS=Mus musculus OX=10090 GN=Npw PE=4 SV=1 CANONICAL=A0A1L1STR8-1", 
        "length": 176, 
        "sequence": "MASNREVRGPGPGTPRNRPLLPLLLLLLLLPLPASAWYKHVASPRYHTVGRASGLLMGLRRSPYQWRRALGGAAGPLSRLPGPVARGALLLPSSGQELWEVRSRSSPAGLPVHAPWSPRDLEGVRQPEQSLSLHSWISEEPAARAFGETLRAQPWFLQQVIFADPVRPKNRWRPHA"
    }, 
    "uniprot_id": "A0A1L1STR8_MOUSE", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "neuropeptide W preproprotein"
            ], 
            "uniprotkb": [
                "Neuropeptide W"
            ]
        }, 
        "gene": {
            "refseq": [
                "Npw", 
                "Gm935"
            ], 
            "uniprotkb": [
                "Npw", 
                "Gm935"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A1L1STR8", 
                    "id": "A0A1L1STR8", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "recommendedname": {
        "full": "Neuropeptide W."
    }, 
    "publication": [
        {
            "title": "Role of brain-derived neurotrophic factor and nerve growth factor in the regulation of Neuropeptide W in vitro and in vivo.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/28249734", 
            "journal": "Molecular and cellular endocrinology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Wang R, Yan F, Liao R, Wan P, Little PJ, Zheng W", 
            "date": "2017", 
            "pmid": "28249734"
        }, 
        {
            "title": "Mesolimbic neuropeptide W coordinates stress responses under novel environments.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/27140610", 
            "journal": "Proceedings of the National Academy of Sciences of the United States of America", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Motoike T, Long JM, Tanaka H, Sinton CM, Skach A, Williams SC, Hammer RE, Sakurai T, Yanagisawa M", 
            "date": "2016", 
            "pmid": "27140610"
        }, 
        {
            "title": "Neuropeptide W modulation of gastric vagal afferent mechanosensitivity: Impact of age and sex.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/26209028", 
            "journal": "Peptides", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Li H, Frisby CL, O'Donnell TA, Kentish SJ, Wittert GA, Page AJ", 
            "date": "2015", 
            "pmid": "26209028"
        }, 
        {
            "title": "Transient expression of neuropeptide W in postnatal mouse hypothalamus--a putative regulator of energy homeostasis.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/26073698", 
            "journal": "Neuroscience", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Motoike T, Skach AG, Godwin JK, Sinton CM, Yamazaki M, Abe M, Natsume R, Sakimura K, Yanagisawa M", 
            "date": "2015", 
            "pmid": "26073698"
        }, 
        {
            "title": "Gastric neuropeptide W is regulated by meal-related nutrients.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/25270269", 
            "journal": "Peptides", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Li H, Feinle-Bisset C, Frisby C, Kentish S, Wittert GA, Page AJ", 
            "date": "2014", 
            "pmid": "25270269"
        }, 
        {
            "title": "Modulation of murine gastric vagal afferent mechanosensitivity by neuropeptide W.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/23927541", 
            "journal": "Acta physiologica (Oxford, England)", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Li H, Kentish SJ, Kritas S, Young RL, Isaacs NJ, O'Donnell TA, Blackshaw LA, Wittert GA, Page AJ", 
            "date": "2013", 
            "pmid": "23927541"
        }, 
        {
            "title": "Neuropeptide W: an anorectic peptide regulated by leptin and metabolic state.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/20189998", 
            "journal": "Endocrinology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Date Y, Mondal MS, Kageyama H, Ghamari-Langroudi M, Takenoya F, Yamaguchi H, Shimomura Y, Mori M, Murakami N, Shioda S, Cone RD, Nakazato M", 
            "date": "2010", 
            "pmid": "20189998"
        }, 
        {
            "title": "Neuropeptide B and W: neurotransmitters in an emerging G-protein-coupled receptor system.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/16847439", 
            "journal": "British journal of pharmacology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Singh G, Davenport AP", 
            "date": "2006", 
            "pmid": "16847439"
        }, 
        {
            "title": "Characterization of a family of endogenous neuropeptide ligands for the G protein-coupled receptors GPR7 and GPR8.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/12719537", 
            "journal": "Proceedings of the National Academy of Sciences of the United States of America", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Tanaka H, Yoshida T, Miyamoto N, Motoike T, Kurosu H, Shibata K, Yamanaka A, Williams SC, Richardson JA, Tsujino N, Garry MG, Lerner MR, King DS, O'Dowd BF, Sakurai T, Yanagisawa M", 
            "date": "2003", 
            "pmid": "12719537"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A1L1STR8#A0A1L1STR8-1", 
            "isoform_ac": "A0A1L1STR8-1", 
            "locus": {
                "end_pos": 24657408, 
                "start_pos": 24658425, 
                "chromosome": "17", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000213213", 
                        "id": "ENSMUST00000213213", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000150440", 
                        "id": "ENSMUSP00000150440", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A0A1L1STR8-1|A0A1L1STR8_MOUSE Isoform 1 of Neuropeptide W  OS=Mus musculus OX=10090 GN=Npw PE=4 SV=1 CANONICAL=A0A1L1STR8-1", 
                "length": 176, 
                "sequence": "MASNREVRGPGPGTPRNRPLLPLLLLLLLLPLPASAWYKHVASPRYHTVGRASGLLMGLRRSPYQWRRALGGAAGPLSRLPGPVARGALLLPSSGQELWEVRSRSSPAGLPVHAPWSPRDLEGVRQPEQSLSLHSWISEEPAARAFGETLRAQPWFLQQVIFADPVRPKNRWRPHA"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0A1L1STR8#F7B5D6-1", 
            "isoform_ac": "F7B5D6-1", 
            "locus": {
                "end_pos": 24657408, 
                "start_pos": 24658425, 
                "chromosome": "17", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000095544", 
                        "id": "ENSMUST00000095544", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000093200", 
                        "id": "ENSMUSP00000093200", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|F7B5D6-1|A0A1L1STR8_MOUSE Computationally mapped isoform of Neuropeptide W  OS=Mus musculus OX=10090 GN=Npw PE=4 SV=1 CANONICAL=A0A1L1STR8-1", 
                "length": 176, 
                "sequence": "LASNREVRGPGPGTPRNRPLLPLLLLLLLLPLPASAWYKHVASPRYHTVGRASGLLMGLRRSPYQWRRALGGAAGPLSRLPGPVARGALLLPSSGQELWEVRSRSSPAGLPVHAPWSPRDLEGVRQPEQSLSLHSWISEEPAARAFGETLRAQPWFLQQVIFADPVRPKNRWRPHA"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:381073", 
            "resource": "KEGG Pathway", 
            "id": "mmu:381073", 
            "name": ""
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", 
            "resource": "Reactome", 
            "id": "R-MMU-418594", 
            "name": "G alpha (i) signalling events"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", 
            "resource": "Reactome", 
            "id": "R-MMU-375276", 
            "name": "Peptide ligand-binding receptors"
        }
    ], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "The effect and underlying mechanisms of NGF/BDNF on the production of NPW in PC12 cells and hypothalamus, is reported.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "These results indicate that the NPW/NPBWR1 system could play a critical role in the gating of stressful stimuli during exposure to novel environments.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "These findings suggest that the physiological role of NPW varies depending on the age of the mice.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "These data suggest that the dorsomedial hypothalamus neurons that transiently co-express NPW and NPY in the peri-weaning period might play a role in regulating energy homeostasis during postnatal development. Erratum:[Neuroscience. 2015 Sep 10;303():630]", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "These studies indicated an inconsistency between plasma and gastric NPW expression in response to nutrient ingestion, suggesting food induced gastric NPW expression may play a more important role locally", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "Neuropeptide W modulates gastric vagal afferent activity", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "Study indicates that NPW may play an important role in the regulation of feeding and energy metabolism.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "annotation": "A non-AUG translation initiation site is used to express the mouse Npw preproprotein", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
                    "id": "NP_001093134.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q8K1M5-1", 
            "protein_name": "Neuropeptide W; Preproprotein L8; PPL8; L8; L8C.", 
            "sequence": {
                "length": 185, 
                "sequence": "MDLSALASSREVRGPGPGAPVNRPLLPLLLLLLLLPLPASAWYKHVASPRYHTVGRASGLLMGLRRSPYLWRRALGGAAGPLVGLPGQMARSALLLPSPGQELWEVRSRSSPAGLPVHATRSLRDLEGAGQPEQSLSFQSWTSAEPAARAFGETLRAQPWFLQQIIFADPVRLDDRLKNRWRPRA"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/17727", 
                    "id": "17727", 
                    "database": "MGI"
                }
            ], 
            "organism": "Rattus norvegicus", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q8N729-1", 
            "protein_name": "Neuropeptide W; Preproprotein L8; hPPL8.", 
            "sequence": {
                "length": 165, 
                "sequence": "MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPYLWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/17727", 
                    "id": "17727", 
                    "database": "MGI"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
        "ac": "NP_001093134.1", 
        "name": "neuropeptide W preproprotein.", 
        "summary": "Orthologs of this gene express a preproprotein that is processed into a neuropeptide ligand for two G-protein coupled receptors in the central nervous system. The neuropeptide is thought to directly or indirectly regulate feeding, weight regulation, and pain response. The preproprotein is translated using a non-AUG initiation codon. [provided by RefSeq, Jul 2008]."
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001664", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A1L1STR8", 
                                "id": "A0A1L1STR8", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "G protein-coupled receptor binding", 
                        "id": "GO:0001664"
                    }
                ], 
                "total": 1, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A1L1STR8", 
                                "id": "A0A1L1STR8", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "G protein-coupled receptor signaling pathway", 
                        "id": "GO:0007186"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007631", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A1L1STR8", 
                                "id": "A0A1L1STR8", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "feeding behavior", 
                        "id": "GO:0007631"
                    }
                ], 
                "total": 2, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093134.1", 
            "id": "NP_001093134.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", 
            "id": "R-MMU-418594", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", 
            "id": "R-MMU-375276", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:381073", 
            "id": "mmu:381073", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013297", 
            "id": "IPR013297", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013299", 
            "id": "IPR013299", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF15180", 
            "id": "PF15180", 
            "database": "Pfam"
        }, 
        {
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28553", 
            "id": "PTHR28553", 
            "database": "PANTHER"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/381073", 
            "id": "381073", 
            "database": "GeneID"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2685781", 
            "id": "2685781", 
            "database": "MGI"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A0A1L1STR8", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 19479.0, 
        "chemical_mass": 19479.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A1L1STR8", 
            "name": "Npw; Gm935.", 
            "locus": {
                "end_pos": 24657330, 
                "start_pos": 24658457, 
                "chromosome": "17", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000071230", 
                        "id": "ENSMUSG00000071230", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}