{ "uniprot_canonical_ac": "A0A140G945-1", "sequence": { "header": "sp|A0A140G945-1|CRYA2_HUMAN Isoform 1 of Alpha-crystallin A2 chain OS=Homo sapiens OX=9606 GN=CRYAA2 PE=1 SV=1 CANONICAL=A0A140G945-1", "length": 173, "sequence": "MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS" }, "uniprot_id": "CRYA2_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "alpha-crystallin A chain isoform 1", "crystallin, alpha-1; human alphaA-crystallin (CRYA1); heat shock protein beta-4; alpha-crystallin A chain" ], "uniprotkb": [ "Alpha-crystallin A2 chain" ] }, "gene": { "refseq": [ "CRYAA", "CRYA1", "CTRCT9", "HSPB4" ], "uniprotkb": [ "CRYAA2", "CRYAA", "CRYA1", "CTRCT9", "HSPB4" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "id": "A0A140G945", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Alpha-crystallin A2 chain." }, "publication": [ { "title": "Asp 58 modulates lens alphaA-crystallin oligomer formation and chaperone function.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/29676852", "journal": "The FEBS journal", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ], "authors": "Takata T, Nakamura-Hirota T, Inoue R, Morishima K, Sato N, Sugiyama M, Fujii N", "date": "2018", "pmid": "29676852" }, { "title": "Structural and functional alteration of human alphaA-crystallin after exposure to full spectrum solar radiation and preventive role of lens antioxidants.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/29964111", "journal": "International journal of biological macromolecules", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ], "authors": "Anbaraki A, Ghahramani M, Muranov KO, Kurganov BI, Yousefi R", "date": "2018", "pmid": "29964111" }, { "title": "A novel mutation in the CRYAA gene associated with congenital cataract and microphthalmia in a Chinese family.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/30340470", "journal": "BMC medical genetics", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ], "authors": "Song Z, Si N, Xiao W", "date": "2018", "pmid": "30340470" }, { "title": "Circular RNA HIPK3 regulates human lens epithelial cells proliferation and apoptosis by targeting the miR-193a/CRYAA axis.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/29959922", "journal": "Biochemical and biophysical research communications", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ], "authors": "Liu X, Liu B, Zhou M, Fan F, Yu M, Gao C, Lu Y, Luo Y", "date": "2018", "pmid": "29959922" }, { "title": "Racemization at the Asp 58 residue in alphaA-crystallin from the lens of high myopic cataract patients.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/28994184", "journal": "Journal of cellular and molecular medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ], "authors": "Zhu XJ, Zhang KK, He WW, Du Y, Hooi M, Lu Y", "date": "2018", "pmid": "28994184" }, { "title": "Identification of histidine residues involved in Zn(2+) binding to alphaA- and alphaB-Crystallin by chemical modification and MALDI TOF mass spectrometry.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22890888", "journal": "Protein J.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Das K.P., Karmakar S.", "date": "2012", "pmid": "22890888" }, { "title": "Acetylation of alphaA-crystallin in the human lens: effects on structure and chaperone function.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22120592", "journal": "Biochim. Biophys. Acta", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Wang B., Biswas A., Linetsky M., Nagaraj R.H., Nahomi R.B., Padmanabha S., Panda A.K., Pasupuleti N., Santhoshkumar P., Shanthakumar S.", "date": "2012", "pmid": "22120592" }, { "title": "Importance of eye lens alpha-crystallin heteropolymer with 3:1 alphaA to alphaB ratio: stability, aggregation, and modifications.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/20836128", "journal": "IUBMB Life", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Petrash J.M., Narahari A., Reddy G.B., Srinivas P., Swamy M.J.", "date": "2010", "pmid": "20836128" }, { "title": "HSPB7 is a SC35 speckle resident small heat shock protein.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19464326", "journal": "Biochim. Biophys. Acta", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Kampinga H.H., Kanon B., Vos M.J.", "date": "2009", "pmid": "19464326" }, { "title": "C-Terminal truncation affects subunit exchange of human alphaA-crystallin with alphaB-crystallin.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/17909943", "journal": "Mol. Cell. Biochem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Aziz A., Abraham E.C., Kallur L.S.", "date": "2008", "pmid": "17909943" }, { "title": "Structural and functional roles of deamidation and/or truncation of N- or C-termini in human alpha A-crystallin.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/18754677", "journal": "Biochemistry", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Gupta R., Chaves J.M., Srivastava K., Srivastava O.P.", "date": "2008", "pmid": "18754677" }, { "title": "Enhanced C-terminal truncation of alphaA- and alphaB-crystallins in diabetic lenses.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/12356833", "journal": "Invest. Ophthalmol. Vis. Sci.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Abraham E.C., Hassan A., Smith J.B., Thampi P.", "date": "2002", "pmid": "12356833" }, { "title": "The major in vivo modifications of the human water-insoluble lens crystallins are disulfide bonds, deamidation, methionine oxidation and backbone cleavage.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/10930324", "journal": "Exp. Eye Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Smith D.L., Hanson S.R.A., Hasan A., Smith J.B.", "date": "2000", "pmid": "10930324" }, { "title": "Quantitation of asparagine-101 deamidation from alpha-A crystallin during aging of the human lens.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/9543632", "journal": "Curr. Eye Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Takemoto L.J.", "date": "1998", "pmid": "9543632" }, { "title": "In vivo acetylation identified at lysine 70 of human lens alphaA-crystallin.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/9655350", "journal": "Protein Sci.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Smith D.L., Barry R.C., Lin P.P., Smith J.B.", "date": "1998", "pmid": "9655350" }, { "title": "Sequence analysis of betaA3, betaB3, and betaA4 crystallins completes the identification of the major proteins in young human lens.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/8999933", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Ma Z., Smith D.L., David L.L., Lampi K.J., Shearer T.R., Shih M., Smith J.B.", "date": "1997", "pmid": "8999933" }, { "title": "Differential phosphorylation of alpha-A crystallin in human lens of different age.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/8759518", "journal": "Exp. Eye Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Takemoto L.J.", "date": "1996", "pmid": "8759518" }, { "title": "Modifications of the water-insoluble human lens alpha-crystallins.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/9068373", "journal": "Exp. Eye Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Smith D.L., Lund A.L., Smith J.B.", "date": "1996", "pmid": "9068373" }, { "title": "Post-translational modifications of water-soluble human lens crystallins from young adults.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/8175657", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Sun Y., Zhou X., Yang Z., Smith D.L., Yang Z.', Miesbauer L.R., Smith J.B.", "date": "1994", "pmid": "8175657" }, { "title": "Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/1730617", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Roquemore EP, Dell A, Morris HR, Panico M, Reason AJ, Savoy LA, Wistow GJ, Zigler JS Jr, Earles BJ, Hart GW", "date": "1992", "pmid": "1730617" }, { "title": "Peripheral nerve changes induced by local application of bee venom.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/894324", "journal": "Journal of neuropathology and experimental neurology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ], "authors": "Saida K, Mendell JR, Sahenk Z", "date": "1977", "pmid": "894324" }, { "title": "The amino acid sequence of the A chain of human alpha-crystallin.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/817940", "journal": "FEBS Lett.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945/publications", "id": "A0A140G945", "database": "UniProtKB" } ], "authors": "Bloemendal H., Terwindt E.C., de Jong W.W.", "date": "1975", "pmid": "817940" } ], "glycosylation": [ { "residue": "Ser", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "id": "A0A140G945", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 162, "glytoucan_ac": "", "type": "O-linked" } ], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945#A0A140G945-1", "isoform_ac": "A0A140G945-1", "locus": { "end_pos": 6560783, "start_pos": 6563961, "chromosome": "21", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000619537", "id": "ENST00000619537", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000482816", "id": "ENSP00000482816", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0A140G945-1|CRYA2_HUMAN Isoform 1 of Alpha-crystallin A2 chain OS=Homo sapiens OX=9606 GN=CRYAA2 PE=1 SV=1 CANONICAL=A0A140G945-1", "length": 173, "sequence": "MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS" } }, { "url": "https://www.uniprot.org/uniprot/A0A140G945#A0A096LPJ9-1", "isoform_ac": "A0A096LPJ9-1", "locus": { "end_pos": 6561487, "start_pos": 6563961, "chromosome": "21", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000624019", "id": "ENST00000624019", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000485653", "id": "ENSP00000485653", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A096LPJ9-1|CRYA2_HUMAN Computationally mapped isoform of Alpha-crystallin A2 chain OS=Homo sapiens OX=9606 GN=CRYAA2 PE=1 SV=1 CANONICAL=A0A140G945-1", "length": 127, "sequence": "MDAPPPHPTTGLLSEPRVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS" } }, { "url": "https://www.uniprot.org/uniprot/A0A140G945#A0A140G945-2", "isoform_ac": "A0A140G945-2", "locus": { "end_pos": 6562016, "start_pos": 6563961, "chromosome": "21", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000624932", "id": "ENST00000624932", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000485302", "id": "ENSP00000485302", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0A140G945-2|CRYA2_HUMAN Isoform 2 of Alpha-crystallin A2 chain OS=Homo sapiens OX=9606 GN=CRYAA2 PE=1 SV=1 CANONICAL=A0A140G945-1", "length": 136, "sequence": "MPVCPGDSHRPPKALPHLVCGRRGRQVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:102724652", "resource": "KEGG Pathway", "id": "hsa:102724652", "name": "" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:1409", "resource": "KEGG Pathway", "id": "hsa:1409", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945#function", "annotation": "Contributes to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945#function", "id": "A0A140G945", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "annotation": "A novel mutation in the CRYAA gene is associated with congenital cataract and microphthalmia in a Chinese family. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "annotation": "Our results suggest that glutathione and ascorbate, as the major anti-oxidant compounds within lenticular tissues, demonstrate controversial effect on structure and chaperone-like activity of human alphaA-Cry.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "annotation": "CircHIPK3 regulates human lens epithelial cells function through miR-193a-mediated CRYAA expression.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "annotation": "Aspartate 58 modulates lens CRYAA protein oligomer formation and chaperone function.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "annotation": "The different trend in the conversion of alphaA-crystallin by racemization, especially the elevated level of d-Asp 58 in high myopic cataract (HMC) lenses, might prompt early cataractogenesis and a possible explanation of distinct phenotypes of cataract in HMC.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "annotation": "Alpha A crystallin is a moonlighting protein that functions as a heat shock protein as well as a lens crystallin.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "P24622-1", "protein_name": "Alpha-crystallin A chain.", "sequence": { "length": 196, "sequence": "MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPVKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48053", "id": "48053", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 }, { "uniprot_canonical_ac": "P24623-1", "protein_name": "Alpha-crystallin A chain.", "sequence": { "length": 196, "sequence": "MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A0A140G945/", "id": "A0A140G945", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/48053", "id": "48053", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "ac": "NP_000385.1", "name": "alpha-crystallin A chain isoform 1; crystallin, alpha-1; human alphaA-crystallin (CRYA1); heat shock protein beta-4; alpha-crystallin A chain.", "summary": "Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Defects in this gene cause autosomal dominant congenital cataract (ADCC). [provided by RefSeq, Jan 2014]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "id": "A0A140G945", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005212", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "id": "A0A140G945", "database": "UniProtKB" } ], "name": "structural constituent of eye lens", "id": "GO:0005212" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "id": "A0A140G945", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "id": "A0A140G945", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" } ], "total": 2, "name": "Cellular Component" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000385.1", "id": "NP_000385.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51901", "id": "51901", "database": "HGNC" }, { "url": "https://www.nextprot.org/entry/NX_A0A140G945", "id": "NX_A0A140G945", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CRYAA2", "id": "CRYAA2", "database": "GeneCards" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:102724652", "id": "hsa:102724652", "database": "KEGG Pathway" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:1409", "id": "hsa:1409", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000160202", "id": "ENSG00000160202", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/GERQDDH/", "id": "GERQDDH", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR008978", "id": "IPR008978", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001436", "id": "IPR001436", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR002068", "id": "IPR002068", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR012274", "id": "IPR012274", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003090", "id": "IPR003090", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF00011", "id": "PF00011", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF00525", "id": "PF00525", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45640:SF14", "id": "PTHR45640:SF14", "database": "PANTHER" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/102724652", "id": "102724652", "database": "GeneID" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/1409", "id": "1409", "database": "GeneID" } ], "expression_disease": [], "uniprot_ac": "A0A140G945", "disease": [ { "doid": "0110266", "url": "http://disease-ontology.org/term/DOID:0110266", "icd10": "Q12.0", "name": "Cataract 9 multiple types [DO disease name]", "evidence": [ { "url": "https://www.omim.org/entry/604219", "id": "604219", "database": "OMIM" } ] } ], "mass": { "monoisotopic_mass": 19909.0, "chemical_mass": 19909.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A140G945", "name": "CRYAA2; CRYAA; CRYA1; CTRCT9; HSPB4.", "locus": { "end_pos": 6564489, "start_pos": 6560714, "chromosome": "21", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000276076", "id": "ENSG00000276076", "database": "Ensembl Gene" } ] } } ] }