{ "uniprot_canonical_ac": "A0A0G2KAD4-1", "sequence": { "header": "tr|A0A0G2KAD4-1|A0A0G2KAD4_RAT Isoform 1 of Protein LBH OS=Rattus norvegicus OX=10116 GN=Lbh PE=1 SV=1 CANONICAL=A0A0G2KAD4-1", "length": 104, "sequence": "VVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ" }, "uniprot_id": "A0A0G2KAD4_RAT", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [], "uniprotkb": [ "Protein LBH" ] }, "gene": { "refseq": [], "uniprotkb": [ "Lbh" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "recommendedname": { "full": "Protein LBH." }, "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22673903", "journal": "Nat. Commun.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4/publications", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "authors": "Olsen J.V., Lage K., Secher A., Dmytriyev A., Lundby A., Lundby C., Nordsborg N.B.", "date": "2012", "pmid": "22673903" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4#F1M635-1", "isoform_ac": "F1M635-1", "locus": { "end_pos": 24163050, "start_pos": 24181714, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000061284", "id": "ENSRNOT00000061284", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000057996", "id": "ENSRNOP00000057996", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|F1M635-1|A0A0G2KAD4_RAT Computationally mapped isoform of Protein LBH OS=Rattus norvegicus OX=10116 GN=Lbh PE=1 SV=3 CANONICAL=A0A0G2KAD4-1", "length": 88, "sequence": "MTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ" } }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4#A0A0G2KAD4-1", "isoform_ac": "A0A0G2KAD4-1", "locus": { "end_pos": 24160226, "start_pos": 24181714, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000091904", "id": "ENSRNOT00000091904", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000075356", "id": "ENSRNOP00000075356", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2KAD4-1|A0A0G2KAD4_RAT Isoform 1 of Protein LBH OS=Rattus norvegicus OX=10116 GN=Lbh PE=1 SV=1 CANONICAL=A0A0G2KAD4-1", "length": 104, "sequence": "VVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTKEKKDQ" } } ], "pathway": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4#function", "annotation": "Transcriptional activator.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4#function", "id": "A0A0G2KAD4", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q9CX60-1", "protein_name": "Protein LBH; Limb bud and heart-expressed protein.", "sequence": { "length": 105, "sequence": "MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A0A0G2KAD4/", "id": "A0A0G2KAD4", "database": "OMA" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "", "ac": "", "name": "", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "protein-containing complex", "id": "GO:0032991" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "negative regulation of transcription, DNA-templated", "id": "GO:0045892" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "positive regulation of transcription, DNA-templated", "id": "GO:0045893" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060644", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "mammary gland epithelial cell differentiation", "id": "GO:0060644" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043408", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "regulation of MAPK cascade", "id": "GO:0043408" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033147", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "negative regulation of intracellular estrogen receptor signaling pathway", "id": "GO:0033147" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000737", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "negative regulation of stem cell differentiation", "id": "GO:2000737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904674", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "positive regulation of somatic stem cell population maintenance", "id": "GO:1904674" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904677", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "positive regulation of somatic stem cell division", "id": "GO:1904677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000103", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "id": "A0A0G2KAD4", "database": "UniProtKB" } ], "name": "positive regulation of mammary stem cell proliferation", "id": "GO:2000103" } ], "total": 9, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000039902", "id": "ENSRNOG00000039902", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/TPMEDMR/", "id": "TPMEDMR", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013294", "id": "IPR013294", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR038990", "id": "IPR038990", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF15317", "id": "PF15317", "database": "Pfam" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1584525", "id": "1584525", "database": "RGD" } ], "expression_disease": [], "uniprot_ac": "A0A0G2KAD4", "disease": [], "mass": { "monoisotopic_mass": 12033.0, "chemical_mass": 12033.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KAD4", "name": "Lbh.", "locus": { "end_pos": 24181866, "start_pos": 24160226, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000039902", "id": "ENSRNOG00000039902", "database": "Ensembl Gene" } ] } } ] }