{ "uniprot_canonical_ac": "A0A0G2K960-1", "sequence": { "header": "tr|A0A0G2K960-1|A0A0G2K960_RAT Isoform 1 of SAM domain, SH3 domain and nuclear localization signals, 1 OS=Rattus norvegicus OX=10116 GN=Samsn1 PE=4 SV=1 CANONICAL=A0A0G2K960-1", "length": 372, "sequence": "MLKRKPSNASEKEKHQKPKRSSSFGNFDRFRNNSISKSDDSIEVRDGELTNGSEEQSKTSNNGGSLGKKVRAISWTMKKKVGKKYIKALSEEKEEEIREETLQYRNSDPMIGTRTEKISLKASDSMDSLYSGQSSSSGITNCSDGTSNRDSFRLDDDSPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKVKVPRSSRRENPQTLQEFLERIHLQEYTSAFLLNGYEALDDLKDIKESHLIELNIANPEDRARLLSAAESLLDEETAAEHEEEPVPLSSNPDILSESQLDDCPRDSGCYISSGNSDNGKEDPESQSLPDMVQKISITEPSD" }, "uniprot_id": "A0A0G2K960_RAT", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "SAM domain-containing protein SAMSN-1", "SAM domain, SH3 domain and nuclear localisation signals, 1" ], "uniprotkb": [ "SAM domain, SH3 domain and nuclear localization signals, 1" ] }, "gene": { "refseq": [ "Samsn1", "Nash" ], "uniprotkb": [ "Samsn1", "rCG_58715", "Nash" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "recommendedname": { "full": "SAM domain, SH3 domain and nuclear localization signals, 1." }, "publication": [ { "title": "Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/22658674", "journal": "Cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" } ], "authors": "Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J, Hentze MW", "date": "2012", "pmid": "22658674" }, { "title": "Enhanced adaptive immunity in mice lacking the immunoinhibitory adaptor Hacs1.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/19923443", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" } ], "authors": "Wang D, Stewart AK, Zhuang L, Zhu Y, Wang Y, Shi C, Keating A, Slutsky A, Zhang H, Wen XY", "date": "2010", "pmid": "19923443" }, { "title": "SLy2 targets the nuclear SAP30/HDAC1 complex.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/20478393", "journal": "The international journal of biochemistry & cell biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" } ], "authors": "Brandt S, Ellwanger K, Beuter-Gunia C, Schuster M, Hausser A, Schmitz I, Beer-Hammer S", "date": "2010", "pmid": "20478393" }, { "title": "The SH3-SAM adaptor HACS1 is up-regulated in B cell activation signaling cascades.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/15381729", "journal": "The Journal of experimental medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" } ], "authors": "Zhu YX, Benn S, Li ZH, Wei E, Masih-Khan E, Trieu Y, Bali M, McGlade CJ, Claudio JO, Stewart AK", "date": "2004", "pmid": "15381729" }, { "title": "Identification of Nash1, a novel protein containing a nuclear localization signal, a sterile alpha motif, and an SH3 domain preferentially expressed in mast cells.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/11594764", "journal": "Biochemical and biophysical research communications", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" } ], "authors": "Uchida T, Nakao A, Nakano N, Kuramasu A, Saito H, Okumura K, Ra C, Ogawa H", "date": "2001", "pmid": "11594764" }, { "title": "HACS1 encodes a novel SH3-SAM adaptor protein differentially expressed in normal and malignant hematopoietic cells.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/11536050", "journal": "Oncogene", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" } ], "authors": "Claudio JO, Zhu YX, Benn SJ, Shukla AH, McGlade CJ, Falcioni N, Stewart AK", "date": "2001", "pmid": "11536050" } ], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960#G3V993-1", "isoform_ac": "G3V993-1", "locus": { "end_pos": 14254050, "start_pos": 14304581, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000040202", "id": "ENSRNOT00000040202", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000039751", "id": "ENSRNOP00000039751", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|G3V993-1|A0A0G2K960_RAT Computationally mapped isoform of SAM domain, SH3 domain and nuclear localization signals, 1 OS=Rattus norvegicus OX=10116 GN=Samsn1 PE=4 SV=2 CANONICAL=A0A0G2K960-1", "length": 364, "sequence": "MLQRRRNTKNRSASSFGNFDRFRNNSISKSDDSIEVRDGELTNGSEEQSKTSNNGGSLGKKVRAISWTMKKKVGKKYIKALSEEKEEEIREETLQYRNSDPMIGTRTEKISLKASDSMDSLYSGQSSSSGITNCSDGTSNRDSFRLDDDSPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKVKVPRSSRRENPQTLQEFLERIHLQEYTSAFLLNGYEALDDLKDIKESHLIELNIANPEDRARLLSAAESLLDEETAAEHEEEPVPLSSNPDILSESQLDDCPRDSGCYISSGNSDNGKEDPESQSLPDMVQKISITEPSD" } }, { "url": "https://www.uniprot.org/uniprot/A0A0G2K960#A0A0G2K960-1", "isoform_ac": "A0A0G2K960-1", "locus": { "end_pos": 14254050, "start_pos": 14304603, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000082143", "id": "ENSRNOT00000082143", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000074870", "id": "ENSRNOP00000074870", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2K960-1|A0A0G2K960_RAT Isoform 1 of SAM domain, SH3 domain and nuclear localization signals, 1 OS=Rattus norvegicus OX=10116 GN=Samsn1 PE=4 SV=1 CANONICAL=A0A0G2K960-1", "length": 372, "sequence": "MLKRKPSNASEKEKHQKPKRSSSFGNFDRFRNNSISKSDDSIEVRDGELTNGSEEQSKTSNNGGSLGKKVRAISWTMKKKVGKKYIKALSEEKEEEIREETLQYRNSDPMIGTRTEKISLKASDSMDSLYSGQSSSSGITNCSDGTSNRDSFRLDDDSPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKVKVPRSSRRENPQTLQEFLERIHLQEYTSAFLLNGYEALDDLKDIKESHLIELNIANPEDRARLLSAAESLLDEETAAEHEEEPVPLSSNPDILSESQLDDCPRDSGCYISSGNSDNGKEDPESQSLPDMVQKISITEPSD" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?rno:170637", "resource": "KEGG Pathway", "id": "rno:170637", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "Q9NSI8-1", "protein_name": "SAM domain-containing protein SAMSN-1; SAM domain, SH3 domain and nuclear localization signals protein 1; Hematopoietic adaptor containing SH3 and SAM domains 1; Nash1; SH3-SAM adaptor protein.", "sequence": { "length": 373, "sequence": "MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/11148", "id": "11148", "database": "MGI" } ], "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "P57725-1", "protein_name": "SAM domain-containing protein SAMSN-1; SH3-lymphocyte protein 2; SLy2; SAM domain, SH3 domain and nuclear localization signals protein 1; SH3 protein expressed in lymphocytes 2.", "sequence": { "length": 372, "sequence": "MLKRKPSNASDKEKHQKPKRSSSFGNFDRFRNNSVSKSDDSIEVHDRELTNGSEEQSKTSSSGGSLGKKVRAISWTMKKKVGKKYIKALSEEKEEESGEEALPYRNSDPMIGTHTEKISLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDSPYSGPFCGRAKVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVILEEEAAPKKIKVPRSRRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLDEETTVEHEKESVPLSSNPDILSASQLEDCPRDSGCYISSENSDNGKEDLESENLSDMVQKIAITESSD" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A0A0G2K960/", "id": "A0A0G2K960", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/11148", "id": "11148", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "ac": "NP_570834.2", "name": "SAM domain-containing protein SAMSN-1; SAM domain, SH3 domain and nuclear localisation signals, 1.", "summary": "human homolog is a putative adaptor and scaffold protein [RGD, Feb 2006]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001784", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "phosphotyrosine residue binding", "id": "GO:0001784" } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" } ], "total": 3, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050869", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "negative regulation of B cell activation", "id": "GO:0050869" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050732", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "negative regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050732" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002820", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "id": "A0A0G2K960", "database": "UniProtKB" } ], "name": "negative regulation of adaptive immune response", "id": "GO:0002820" } ], "total": 3, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 10, "annotation": "n_glycosylation_sequon", "start_pos": 8 }, { "end_pos": 34, "annotation": "n_glycosylation_sequon", "start_pos": 32 }, { "end_pos": 53, "annotation": "n_glycosylation_sequon", "start_pos": 51 }, { "end_pos": 143, "annotation": "n_glycosylation_sequon", "start_pos": 141 } ], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_570834.2", "id": "NP_570834.2", "database": "RefSeq" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?rno:170637", "id": "rno:170637", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000030930", "id": "ENSRNOG00000030930", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/NLPDMVQ/", "id": "NLPDMVQ", "database": "OMA" }, { "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09561", "id": "cd09561", "database": "CDD" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR021090", "id": "IPR021090", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "id": "IPR001452", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "id": "IPR036028", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001660", "id": "IPR001660", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013761", "id": "IPR013761", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR037623", "id": "IPR037623", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF12485", "id": "PF12485", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF07647", "id": "PF07647", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF07653", "id": "PF07653", "database": "Pfam" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/170637", "id": "170637", "database": "GeneID" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620926", "id": "620926", "database": "RGD" } ], "expression_disease": [], "uniprot_ac": "A0A0G2K960", "disease": [], "mass": { "monoisotopic_mass": 41604.0, "chemical_mass": 41604.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K960", "name": "Samsn1; rCG_58715; Nash.", "locus": { "end_pos": 14253848, "start_pos": 14304725, "chromosome": "11", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000030930", "id": "ENSRNOG00000030930", "database": "Ensembl Gene" } ] } } ] }