{
    "uniprot_canonical_ac": "A0A0G2JUZ2-1", 
    "sequence": {
        "header": "tr|A0A0G2JUZ2-1|A0A0G2JUZ2_RAT Isoform 1 of Leucine-rich repeat-containing 75B  OS=Rattus norvegicus OX=10116 GN=Lrrc75b PE=4 SV=2 CANONICAL=A0A0G2JUZ2-1", 
        "length": 306, 
        "sequence": "MGARLGRRARADAPAAPSAGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLEGNLLTDILYRNVTFLNLVDPISHDLLVNLARDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKPHRKTQSSLKSSLQKTLLVGETVDLSGIPLSARDVQHISRYLDSRGVELVVLDLSFTELSDDLLHLLLPSLWALPRLTQLLLNGNRLTRAAARELTEAIKDATKFPVLAWVDLGNNVDVSSLPQPLLVGLRRRLSQHTSLPTIYEGLDLEPGGGMAETTAAVSTWGSAATEAGPEPQGCCAR"
    }, 
    "uniprot_id": "A0A0G2JUZ2_RAT", 
    "enzyme_annotation": [], 
    "synonyms": {
        "protein": {
            "refseq": [
                "leucine-rich repeat-containing protein 75B", 
                "leucine-rich repeat-containing protein FAM211B; family with sequence similarity 211, member B"
            ], 
            "uniprotkb": [
                "Leucine-rich repeat-containing 75B"
            ]
        }, 
        "gene": {
            "refseq": [
                "Lrrc75b", 
                "Fam211b"
            ], 
            "uniprotkb": [
                "Lrrc75b", 
                "Fam211b"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A0G2JUZ2", 
                    "id": "A0A0G2JUZ2", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Rattus norvegicus", 
            "taxid": 10116
        }
    ], 
    "recommendedname": {
        "full": "Leucine-rich repeat-containing 75B."
    }, 
    "publication": [
        {
            "title": "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/12477932", 
            "journal": "Proceedings of the National Academy of Sciences of the United States of America", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094486.2", 
                    "id": "NP_001094486.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA", 
            "date": "2002", 
            "pmid": "12477932"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A0G2JUZ2#A0A0G2JUZ2-1", 
            "isoform_ac": "A0A0G2JUZ2-1", 
            "locus": {
                "end_pos": 14050506, 
                "start_pos": 14056634, 
                "chromosome": "20", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000089319", 
                        "id": "ENSRNOT00000089319", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000069288", 
                        "id": "ENSRNOP00000069288", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A0A0G2JUZ2-1|A0A0G2JUZ2_RAT Isoform 1 of Leucine-rich repeat-containing 75B  OS=Rattus norvegicus OX=10116 GN=Lrrc75b PE=4 SV=2 CANONICAL=A0A0G2JUZ2-1", 
                "length": 306, 
                "sequence": "MGARLGRRARADAPAAPSAGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLEGNLLTDILYRNVTFLNLVDPISHDLLVNLARDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKPHRKTQSSLKSSLQKTLLVGETVDLSGIPLSARDVQHISRYLDSRGVELVVLDLSFTELSDDLLHLLLPSLWALPRLTQLLLNGNRLTRAAARELTEAIKDATKFPVLAWVDLGNNVDVSSLPQPLLVGLRRRLSQHTSLPTIYEGLDLEPGGGMAETTAAVSTWGSAATEAGPEPQGCCAR"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0A0G2JUZ2#M0RA11-1", 
            "isoform_ac": "M0RA11-1", 
            "locus": {
                "end_pos": 14050537, 
                "start_pos": 14054608, 
                "chromosome": "20", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000074783", 
                        "id": "ENSRNOT00000074783", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000066347", 
                        "id": "ENSRNOP00000066347", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|M0RA11-1|A0A0G2JUZ2_RAT Computationally mapped isoform of Leucine-rich repeat-containing 75B  OS=Rattus norvegicus OX=10116 GN=Lrrc75b PE=4 SV=2 CANONICAL=A0A0G2JUZ2-1", 
                "length": 140, 
                "sequence": "XDAPAAPSAGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLEGNLLTDILYRNVTFLNLVDPISHDLLVNLARDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKPHRKTQSRLTIWLQSCQQPQQQMPPS"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:100365744", 
            "resource": "KEGG Pathway", 
            "id": "rno:100365744", 
            "name": ""
        }
    ], 
    "function": [], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q2VPJ9-1", 
            "protein_name": "Leucine-rich repeat-containing protein 75B; Leucine-rich repeat-containing protein FAM211B.", 
            "sequence": {
                "length": 315, 
                "sequence": "MGARLGRRAGPEAGSEAGAAAGCGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLERTLLPDILYRDVAFLNPVDPISHDLLVNLARDLQCPKKDYELWKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETVDLSGIPLSTQDVQHITRYLSSHGAVLAVLDLSFTGLSDELLHLLLPSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTTKFPALAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGLDLEPEGSAAGATTPASTWDSTAAGLGPEPQACCAR"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/65995", 
                    "id": "65995", 
                    "database": "MGI"
                }
            ], 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }, 
        {
            "uniprot_canonical_ac": "Q7TPD7-1", 
            "protein_name": "Leucine-rich repeat-containing protein 75B; Leucine-rich repeat-containing protein FAM211B.", 
            "sequence": {
                "length": 306, 
                "sequence": "MGARLGRRARADAPAAPSAGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLEGNLLTDILHRNVTFLNLVDPISHDLLVNLARDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKHHRKTQSSLKSSLQKTLLVGETVDLSGIPLSARDVQHISRYLDTRGVELVVLDLSFTELSDELLHLLLPSLWALPRLTQLLLNGNRLTRAAARELTEAIKDTAKFPVLAWVDLGNNVDVSSLPQPLLVGLRRRLSQHTSLPTIYEGLDLEPGGGMAETTAAVSTWGSAATEAGPEPQGCCAR"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/65995", 
                    "id": "65995", 
                    "database": "MGI"
                }
            ], 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094486.2", 
        "ac": "NP_001094486.2", 
        "name": "leucine-rich repeat-containing protein 75B; leucine-rich repeat-containing protein FAM211B; family with sequence similarity 211, member B.", 
        "summary": ""
    }, 
    "go_annotation": {}, 
    "site_annotation": [
        {
            "end_pos": 73, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 71
        }
    ], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094486.2", 
            "id": "NP_001094486.2", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/www_bget?rno:100365744", 
            "id": "rno:100365744", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000046428", 
            "id": "ENSRNOG00000046428", 
            "database": "Bgee"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/IYEYTEG/", 
            "id": "IYEYTEG", 
            "database": "OMA"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", 
            "id": "IPR032675", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/100365744", 
            "id": "100365744", 
            "database": "GeneID"
        }, 
        {
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2318441", 
            "id": "2318441", 
            "database": "RGD"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A0A0G2JUZ2", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 34118.0, 
        "chemical_mass": 34118.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A0G2JUZ2", 
            "name": "Lrrc75b; Fam211b.", 
            "locus": {
                "end_pos": 14060264, 
                "start_pos": 14050465, 
                "chromosome": "20", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOG00000046428", 
                        "id": "ENSRNOG00000046428", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}