{ "uniprot_canonical_ac": "A0A0C4DH36-1", "sequence": { "header": "tr|A0A0C4DH36-1|A0A0C4DH36_HUMAN Isoform 1 of Immunoglobulin heavy variable 3-38 (non-functional) OS=Homo sapiens OX=9606 GN=IGHV3-38 PE=1 SV=1 CANONICAL=A0A0C4DH36-1", "length": 116, "sequence": "MQFVLSWVFLVGILKGVQCEVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY" }, "uniprot_id": "A0A0C4DH36_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [], "uniprotkb": [ "Immunoglobulin heavy variable 3-38 (non-functional)" ] }, "gene": { "refseq": [], "uniprotkb": [ "IGHV3-38" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Immunoglobulin heavy variable 3-38 (non-functional)." }, "publication": [], "glycosylation": [], "mutation": [ { "start_pos": 107, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A0C4DH36", "id": "A0A0C4DH36", "database": "BioMuta" } ], "frequency": "2.0", "annotation": "Filters passed (1/5): patient freq. (2.0%).", "sequence_org": "G", "disease": { "doid": "1781", "url": "http://disease-ontology.org/term/DOID:1781", "icd10": "", "name": "Thyroid cancer" }, "sequence_mut": "D", "subjects_tested": "50", "end_pos": 107, "type": "Point mutation" }, { "start_pos": 48, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A0C4DH36", "id": "A0A0C4DH36", "database": "BioMuta" } ], "frequency": "0.2", "annotation": "Filters passed (1/5): num. of cancers (4).", "sequence_org": "V", "disease": { "doid": "3571", "url": "http://disease-ontology.org/term/DOID:3571", "icd10": "", "name": "Liver cancer" }, "sequence_mut": "I", "subjects_tested": "412", "end_pos": 48, "type": "Point mutation" }, { "start_pos": 48, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A0C4DH36", "id": "A0A0C4DH36", "database": "BioMuta" } ], "frequency": "0.1", "annotation": "Filters passed (1/5): num. of cancers (4).", "sequence_org": "V", "disease": { "doid": "10534", "url": "http://disease-ontology.org/term/DOID:10534", "icd10": "", "name": "Stomach cancer" }, "sequence_mut": "I", "subjects_tested": "1044", "end_pos": 48, "type": "Point mutation" }, { "start_pos": 48, "subjects_positive": "2", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A0C4DH36", "id": "A0A0C4DH36", "database": "BioMuta" } ], "frequency": "0.4", "annotation": "Filters passed (1/5): num. of cancers (4).", "sequence_org": "V", "disease": { "doid": "363", "url": "http://disease-ontology.org/term/DOID:363", "icd10": "", "name": "Uterine cancer" }, "sequence_mut": "I", "subjects_tested": "558", "end_pos": 48, "type": "Point mutation" }, { "start_pos": 12, "subjects_positive": "2", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A0C4DH36", "id": "A0A0C4DH36", "database": "BioMuta" } ], "frequency": "1.6", "annotation": "Filters passed (1/5): patient freq. (1.6%).", "sequence_org": "G", "disease": { "doid": "2531", "url": "http://disease-ontology.org/term/DOID:2531", "icd10": "", "name": "Hematologic cancer" }, "sequence_mut": "A", "subjects_tested": "125", "end_pos": 12, "type": "Point mutation" }, { "start_pos": 48, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A0C4DH36", "id": "A0A0C4DH36", "database": "BioMuta" } ], "frequency": "0.2", "annotation": "Filters passed (1/5): num. of cancers (4).", "sequence_org": "V", "disease": { "doid": "1612", "url": "http://disease-ontology.org/term/DOID:1612", "icd10": "", "name": "Breast cancer" }, "sequence_mut": "I", "subjects_tested": "569", "end_pos": 48, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36#A0A0C4DH36-1", "isoform_ac": "A0A0C4DH36-1", "locus": { "end_pos": 106435174, "start_pos": 106435624, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000631785", "id": "ENST00000631785", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000487804", "id": "ENSP00000487804", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0C4DH36-1|A0A0C4DH36_HUMAN Isoform 1 of Immunoglobulin heavy variable 3-38 (non-functional) OS=Homo sapiens OX=9606 GN=IGHV3-38 PE=1 SV=1 CANONICAL=A0A0C4DH36-1", "length": 116, "sequence": "MQFVLSWVFLVGILKGVQCEVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY" } } ], "pathway": [], "function": [], "orthologs": [], "refseq": { "url": "", "ac": "", "name": "", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034987", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "immunoglobulin receptor binding", "id": "GO:0034987" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "antigen binding", "id": "GO:0003823" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "external side of plasma membrane", "id": "GO:0009897" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042571", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "immunoglobulin complex, circulating", "id": "GO:0042571" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006911", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "phagocytosis, engulfment", "id": "GO:0006911" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "innate immune response", "id": "GO:0045087" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "B cell receptor signaling pathway", "id": "GO:0050853" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "defense response to bacterium", "id": "GO:0042742" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006910", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "phagocytosis, recognition", "id": "GO:0006910" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050871", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "positive regulation of B cell activation", "id": "GO:0050871" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "id": "A0A0C4DH36", "database": "UniProtKB" } ], "name": "complement activation, classical pathway", "id": "GO:0006958" } ], "total": 7, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5601", "id": "5601", "database": "HGNC" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHV3-38", "id": "IGHV3-38", "database": "GeneCards" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211958", "id": "ENSG00000211958", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/RGHECEP/", "id": "RGHECEP", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "id": "IPR007110", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "id": "IPR013783", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "id": "IPR036179", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "id": "IPR013106", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF07686", "id": "PF07686", "database": "Pfam" } ], "expression_disease": [], "uniprot_ac": "A0A0C4DH36", "disease": [], "mass": { "monoisotopic_mass": 12759.0, "chemical_mass": 12759.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A0C4DH36", "name": "IGHV3-38.", "locus": { "end_pos": 106410493, "start_pos": 106411021, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000211958", "id": "ENSG00000211958", "database": "Ensembl Gene" } ] } } ] }