{ "uniprot_canonical_ac": "A0A096LP55-1", "sequence": { "header": "sp|A0A096LP55-1|QCR6L_HUMAN Isoform 1 of Cytochrome b-c1 complex subunit 6-like, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRHL PE=3 SV=1 CANONICAL=A0A096LP55-1", "length": 91, "sequence": "MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK" }, "uniprot_id": "QCR6L_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [ "cytochrome b-c1 complex subunit 6-like, mitochondrial", "hCG25371" ], "uniprotkb": [ "Cytochrome b-c1 complex subunit 6-like, mitochondrial" ] }, "gene": { "refseq": [ "UQCRHL" ], "uniprotkb": [ "UQCRHL" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55", "id": "A0A096LP55", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Cytochrome b-c1 complex subunit 6-like, mitochondrial." }, "publication": [], "glycosylation": [], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55#A0A096LP55-1", "isoform_ac": "A0A096LP55-1", "locus": { "end_pos": 15807377, "start_pos": 15807649, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000483273", "id": "ENST00000483273", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000485401", "id": "ENSP00000485401", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0A096LP55-1|QCR6L_HUMAN Isoform 1 of Cytochrome b-c1 complex subunit 6-like, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRHL PE=3 SV=1 CANONICAL=A0A096LP55-1", "length": 91, "sequence": "MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:440567", "resource": "KEGG Pathway", "id": "hsa:440567", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55#function", "annotation": "May be a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55#function", "id": "A0A096LP55", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q5M9I5-1", "protein_name": "Cytochrome b-c1 complex subunit 6, mitochondrial; Cytochrome c1 non-heme 11 kDa protein; Complex III subunit VIII; Mitochondrial hinge protein; Complex III subunit 6; Ubiquinol-cytochrome c reductase complex 11 kDa protein.", "sequence": { "length": 89, "sequence": "MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLESCDRRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKSLK" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/134032", "id": "134032", "database": "MGI" } ], "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "P99028-1", "protein_name": "Cytochrome b-c1 complex subunit 6, mitochondrial; Cytochrome c1 non-heme 11 kDa protein; Complex III subunit VIII; Mitochondrial hinge protein; Complex III subunit 6; Ubiquinol-cytochrome c reductase complex 11 kDa protein.", "sequence": { "length": 89, "sequence": "MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/134032", "id": "134032", "database": "MGI" } ], "organism": "Mus musculus", "tax_id": 10090 } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001083060.1", "ac": "NP_001083060.1", "name": "cytochrome b-c1 complex subunit 6-like, mitochondrial; hCG25371.", "summary": "This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. [provided by RefSeq, Jul 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008121", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55", "id": "A0A096LP55", "database": "UniProtKB" } ], "name": "ubiquinol-cytochrome-c reductase activity", "id": "GO:0008121" } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005750", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55", "id": "A0A096LP55", "database": "UniProtKB" } ], "name": "mitochondrial respiratory chain complex III", "id": "GO:0005750" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009060", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55", "id": "A0A096LP55", "database": "UniProtKB" } ], "name": "aerobic respiration", "id": "GO:0009060" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006122", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55", "id": "A0A096LP55", "database": "UniProtKB" } ], "name": "mitochondrial electron transport, ubiquinol to cytochrome c", "id": "GO:0006122" } ], "total": 2, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001083060.1", "id": "NP_001083060.1", "database": "RefSeq" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51714", "id": "51714", "database": "HGNC" }, { "url": "https://pharos.nih.gov/targets/A0A096LP55", "id": "A0A096LP55", "database": "PHAROS" }, { "url": "https://www.nextprot.org/entry/NX_A0A096LP55", "id": "NX_A0A096LP55", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UQCRHL", "id": "UQCRHL", "database": "GeneCards" }, { "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:440567", "id": "hsa:440567", "database": "KEGG Pathway" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233954", "id": "ENSG00000233954", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/ECVERVQ/", "id": "ECVERVQ", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003422", "id": "IPR003422", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR023184", "id": "IPR023184", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036811", "id": "IPR036811", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF02320", "id": "PF02320", "database": "Pfam" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15336", "id": "PTHR15336", "database": "PANTHER" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0A096LP55", "id": "PR_A0A096LP55", "database": "PRO" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A096LP55*", "id": "A0A096LP55", "database": "IntAct" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/440567", "id": "440567", "database": "GeneID" } ], "expression_disease": [], "uniprot_ac": "A0A096LP55", "disease": [], "mass": { "monoisotopic_mass": 10752.0, "chemical_mass": 10752.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A096LP55", "name": "UQCRHL.", "locus": { "end_pos": 15807169, "start_pos": 15809348, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000233954", "id": "ENSG00000233954", "database": "Ensembl Gene" } ] } } ] }