{ "uniprot_canonical_ac": "A0A087WT02-1", "sequence": { "header": "sp|A0A087WT02-1|TVA92_HUMAN Isoform 1 of T cell receptor alpha variable 9-2 OS=Homo sapiens OX=9606 GN=TRAV9-2 PE=3 SV=1 CANONICAL=A0A087WT02-1", "length": 112, "sequence": "MNYSPGLVSLILLLLGRTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS" }, "uniprot_id": "TVA92_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [], "uniprotkb": [ "T cell receptor alpha variable 9-2" ] }, "gene": { "refseq": [], "uniprotkb": [ "TRAV9-2" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "T cell receptor alpha variable 9-2." }, "publication": [ { "title": "T cell antigen receptor recognition of antigen-presenting molecules.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/25493333", "journal": "Annu. Rev. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02/publications", "id": "A0A087WT02", "database": "UniProtKB" } ], "authors": "Rossjohn J., Gras S., McCluskey J., Godfrey D.I., Miles J.J., Turner S.J.", "date": "2015", "pmid": "25493333" }, { "title": "Immunoglobulin and T Cell Receptor Genes: IMGT((R)) and the Birth and Rise of Immunoinformatics.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/24600447", "journal": "Front. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02/publications", "id": "A0A087WT02", "database": "UniProtKB" } ], "authors": "Lefranc M.P.", "date": "2014", "pmid": "24600447" }, { "title": "T cell receptor signalling networks: branched, diversified and bounded.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/23524462", "journal": "Nat. Rev. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02/publications", "id": "A0A087WT02", "database": "UniProtKB" } ], "authors": "Zamoyska R., Brownlie R.J.", "date": "2013", "pmid": "23524462" }, { "title": "Structural biology of the T-cell receptor: insights into receptor assembly, ligand recognition, and initiation of signaling.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/20452950", "journal": "Cold Spring Harb. Perspect. Biol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02/publications", "id": "A0A087WT02", "database": "UniProtKB" } ], "authors": "Gagnon E., Wucherpfennig K.W., Call M.E., Call M.J., Huseby E.S.", "date": "2010", "pmid": "20452950" }, { "title": "The many important facets of T-cell repertoire diversity.", "url": "https://www.ncbi.nlm.nih.gov/pubmed/15040585", "journal": "Nat. Rev. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02/publications", "id": "A0A087WT02", "database": "UniProtKB" } ], "authors": "Messaoudi I., Nikolich-Zugich J., Slifka M.K.", "date": "2004", "pmid": "15040585" } ], "glycosylation": [ { "residue": "Asn", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ], "relation": "attached", "position": 41, "glytoucan_ac": "", "type": "N-linked" } ], "mutation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02#A0A087WT02-1", "isoform_ac": "A0A087WT02-1", "locus": { "end_pos": 21941184, "start_pos": 21941655, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000390441", "id": "ENST00000390441", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000452011", "id": "ENSP00000452011", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0A087WT02-1|TVA92_HUMAN Isoform 1 of T cell receptor alpha variable 9-2 OS=Homo sapiens OX=9606 GN=TRAV9-2 PE=3 SV=1 CANONICAL=A0A087WT02-1", "length": 112, "sequence": "MNYSPGLVSLILLLLGRTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS" } } ], "pathway": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02#function", "annotation": "V region of the variable domain of T cell receptor (TR) alpha chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NF-kappa-B (NF-kB) pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation (PubMed:23524462). The T cell repertoire is generated in the thymus, by V-(D)-J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity (PubMed:15040585).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02#function", "id": "A0A087WT02", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "M0R7S3-1", "protein_name": "Ig-like domain-containing protein.", "sequence": { "length": 138, "sequence": "LKMDSSPGFVAVILLLLGRTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALGDTVAETTGGAEHKPRGNRWSDC" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A0A087WT02/", "id": "A0A087WT02", "database": "OMA" } ], "organism": "Rattus norvegicus", "tax_id": 10116 } ], "refseq": { "url": "", "ac": "", "name": "", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" } ], "name": "extracellular space", "id": "GO:0005615" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" } ], "name": "T cell receptor complex", "id": "GO:0042101" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" } ], "name": "immune response", "id": "GO:0006955" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002377", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" } ], "name": "immunoglobulin production", "id": "GO:0002377" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "id": "A0A087WT02", "database": "UniProtKB" } ], "name": "adaptive immune response", "id": "GO:0002250" } ], "total": 3, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 4, "annotation": "n_glycosylation_sequon", "start_pos": 2 }, { "end_pos": 43, "annotation": "n_glycosylation_sequon", "start_pos": 41 } ], "crossref": [ { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12154", "id": "12154", "database": "HGNC" }, { "url": "https://www.nextprot.org/entry/NX_A0A087WT02", "id": "NX_A0A087WT02", "database": "neXtProt" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TRAV9-2", "id": "TRAV9-2", "database": "GeneCards" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211793", "id": "ENSG00000211793", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/AVKANDM/", "id": "AVKANDM", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "id": "IPR007110", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "id": "IPR013783", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "id": "IPR036179", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "id": "IPR013106", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF07686", "id": "PF07686", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A0A087WT02", "id": "PR_A0A087WT02", "database": "PRO" } ], "expression_disease": [], "uniprot_ac": "A0A087WT02", "disease": [], "mass": { "monoisotopic_mass": 12289.0, "chemical_mass": 12289.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A087WT02", "name": "TRAV9-2.", "locus": { "end_pos": 21941657, "start_pos": 21941128, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000211793", "id": "ENSG00000211793", "database": "Ensembl Gene" } ] } } ] }