{ "uniprot_canonical_ac": "A0A075B7D8-1", "sequence": { "header": "tr|A0A075B7D8-1|A0A075B7D8_HUMAN Isoform 1 of Immunoglobulin heavy variable 3/OR15-7 (pseudogene) OS=Homo sapiens OX=9606 GN=IGHV3OR15-7 PE=1 SV=1 CANONICAL=A0A075B7D8-1", "length": 119, "sequence": "MEFGLSWVFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMSWVRQAQGKGLELVGLIRNKANSYTTEYAASVKGRLTISREDSKNTLYLQMSNLKTEDLAVYYCAR" }, "uniprot_id": "A0A075B7D8_HUMAN", "enzyme_annotation": [], "synonyms": { "protein": { "refseq": [], "uniprotkb": [ "Immunoglobulin heavy variable 3/OR15-7 (pseudogene)" ] }, "gene": { "refseq": [], "uniprotkb": [ "IGHV3OR15-7" ] } }, "keywords": [], "species": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "recommendedname": { "full": "Immunoglobulin heavy variable 3/OR15-7 (pseudogene)." }, "publication": [], "glycosylation": [], "mutation": [ { "start_pos": 81, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7D8", "id": "A0A075B7D8", "database": "BioMuta" } ], "frequency": "1.1", "annotation": "Filters passed (1/5): patient freq. (1.1%).", "sequence_org": "Y", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "C", "subjects_tested": "94", "end_pos": 81, "type": "Point mutation" }, { "start_pos": 97, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7D8", "id": "A0A075B7D8", "database": "BioMuta" } ], "frequency": "1.1", "annotation": "Filters passed (1/5): patient freq. (1.1%).", "sequence_org": "K", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "N", "subjects_tested": "94", "end_pos": 97, "type": "Point mutation" }, { "start_pos": 63, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7D8", "id": "A0A075B7D8", "database": "BioMuta" } ], "frequency": "1.5", "annotation": "Filters passed (1/5): patient freq. (1.5%).", "sequence_org": "G", "disease": { "doid": "1324", "url": "http://disease-ontology.org/term/DOID:1324", "icd10": "", "name": "Lung cancer" }, "sequence_mut": "E", "subjects_tested": "66", "end_pos": 63, "type": "Point mutation" }, { "start_pos": 98, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7D8", "id": "A0A075B7D8", "database": "BioMuta" } ], "frequency": "1.1", "annotation": "Filters passed (1/5): patient freq. (1.1%).", "sequence_org": "N", "disease": { "doid": "9256", "url": "http://disease-ontology.org/term/DOID:9256", "icd10": "", "name": "Colorectal cancer" }, "sequence_mut": "S", "subjects_tested": "94", "end_pos": 98, "type": "Point mutation" }, { "start_pos": 83, "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A0A075B7D8", "id": "A0A075B7D8", "database": "BioMuta" } ], "frequency": "1.5", "annotation": "Filters passed (1/5): patient freq. (1.5%).", "sequence_org": "A", "disease": { "doid": "1324", "url": "http://disease-ontology.org/term/DOID:1324", "icd10": "", "name": "Lung cancer" }, "sequence_mut": "S", "subjects_tested": "66", "end_pos": 83, "type": "Point mutation" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8#A0A075B7D8-1", "isoform_ac": "A0A075B7D8-1", "locus": { "end_pos": 19987658, "start_pos": 19988117, "chromosome": "15", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000558565", "id": "ENST00000558565", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000474509", "id": "ENSP00000474509", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A075B7D8-1|A0A075B7D8_HUMAN Isoform 1 of Immunoglobulin heavy variable 3/OR15-7 (pseudogene) OS=Homo sapiens OX=9606 GN=IGHV3OR15-7 PE=1 SV=1 CANONICAL=A0A075B7D8-1", "length": 119, "sequence": "MEFGLSWVFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMSWVRQAQGKGLELVGLIRNKANSYTTEYAASVKGRLTISREDSKNTLYLQMSNLKTEDLAVYYCAR" } } ], "pathway": [], "function": [], "orthologs": [], "refseq": { "url": "", "ac": "", "name": "", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034987", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "immunoglobulin receptor binding", "id": "GO:0034987" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "antigen binding", "id": "GO:0003823" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "external side of plasma membrane", "id": "GO:0009897" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042571", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "immunoglobulin complex, circulating", "id": "GO:0042571" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006911", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "phagocytosis, engulfment", "id": "GO:0006911" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "innate immune response", "id": "GO:0045087" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "B cell receptor signaling pathway", "id": "GO:0050853" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "defense response to bacterium", "id": "GO:0042742" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006910", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "phagocytosis, recognition", "id": "GO:0006910" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050871", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "positive regulation of B cell activation", "id": "GO:0050871" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "id": "A0A075B7D8", "database": "UniProtKB" } ], "name": "complement activation, classical pathway", "id": "GO:0006958" } ], "total": 7, "name": "Biological Process" } ] }, "site_annotation": [], "crossref": [ { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5633", "id": "5633", "database": "HGNC" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHV3OR15-7", "id": "IGHV3OR15-7", "database": "GeneCards" }, { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000259490", "id": "ENSG00000259490", "database": "Bgee" }, { "url": "https://omabrowser.org/oma/group/CEPRCKP/", "id": "CEPRCKP", "database": "OMA" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "id": "IPR007110", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "id": "IPR013783", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "id": "IPR036179", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "id": "IPR013106", "database": "InterPro" }, { "url": "http://pfam.xfam.org/family/PF07686", "id": "PF07686", "database": "Pfam" } ], "expression_disease": [], "uniprot_ac": "A0A075B7D8", "disease": [], "mass": { "monoisotopic_mass": 13080.0, "chemical_mass": 13080.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A075B7D8", "name": "IGHV3OR15-7.", "locus": { "end_pos": 19987656, "start_pos": 19988117, "chromosome": "15", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000259490", "id": "ENSG00000259490", "database": "Ensembl Gene" } ] } } ] }