{
    "uniprot_canonical_ac": "A0A024RBG1-1", 
    "sequence": {
        "header": "sp|A0A024RBG1-1|NUD4B_HUMAN Isoform 1 of Diphosphoinositol polyphosphate phosphohydrolase NUDT4B  OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1 CANONICAL=A0A024RBG1-1", 
        "length": 181, 
        "sequence": "MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR"
    }, 
    "uniprot_id": "NUD4B_HUMAN", 
    "enzyme_annotation": [
        {
            "ec": "3.6.1.52", 
            "activity": "Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate."
        }, 
        {
            "ec": "3.6.1.52", 
            "activity": ""
        }
    ], 
    "synonyms": {
        "protein": {
            "refseq": [
                "diphosphoinositol polyphosphate phosphohydrolase 2 isoform beta", 
                "diphosphoinositol polyphosphate phosphohydrolase type 2; DIPP-2; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; nudix (nucleoside diphosphate linked moiety X)-type motif 4; Diphosphoinositol polyphosphate phosphohydrolase NUDT4B; Nucleoside diphosphate-linked moiety X motif 4B; Nudix hydrolase 4B; Nudix motif 4B"
            ], 
            "uniprotkb": [
                "Diphosphoinositol polyphosphate phosphohydrolase NUDT4B", 
                "DIPP-2B", 
                "3.6.1.52", 
                "Nucleoside diphosphate-linked moiety X motif 4B", 
                "Nudix motif 4B", 
                "Nudix hydrolase 4B"
            ]
        }, 
        "gene": {
            "refseq": [
                "NUDT4", 
                "DIPP-2B", 
                "DIPP2", 
                "DIPP2alpha", 
                "DIPP2beta", 
                "HDCMB47P", 
                "NUDT4B"
            ], 
            "uniprotkb": [
                "NUDT4B", 
                "NUDT4", 
                "DIPP-2B", 
                "DIPP2", 
                "DIPP2alpha", 
                "DIPP2beta", 
                "HDCMB47P"
            ]
        }
    }, 
    "keywords": [], 
    "species": [
        {
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                    "id": "A0A024RBG1", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Homo sapiens", 
            "taxid": 9606
        }
    ], 
    "recommendedname": {
        "full": "Diphosphoinositol polyphosphate phosphohydrolase NUDT4B; DIPP-2B; 3.6.1.52; Nucleoside diphosphate-linked moiety X motif 4B; Nudix motif 4B; Nudix hydrolase 4B.", 
        "short": "DIPP-2B"
    }, 
    "publication": [
        {
            "title": "Lineage-specific gene duplication and loss in human and great ape evolution.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/15252450", 
            "journal": "PLoS biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
                    "id": "NP_950241.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Fortna A, Kim Y, MacLaren E, Marshall K, Hahn G, Meltesen L, Brenton M, Hink R, Burgers S, Hernandez-Boussard T, Karimpour-Fard A, Glueck D, McGavran L, Berry R, Pollack J, Sikela JM", 
            "date": "2004", 
            "pmid": "15252450"
        }, 
        {
            "title": "Cloning and characterisation of hAps1 and hAps2, human diadenosine polyphosphate-metabolising Nudix hydrolases.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/12121577", 
            "journal": "BMC biochemistry", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
                    "id": "NP_950241.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Leslie NR, McLennan AG, Safrany ST", 
            "date": "2002", 
            "pmid": "12121577"
        }, 
        {
            "title": "Nudix hydrolases that degrade dinucleoside and diphosphoinositol polyphosphates also have 5-phosphoribosyl 1-pyrophosphate (PRPP) pyrophosphatase activity that generates the glycolytic activator ribose 1,5-bisphosphate.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/12370170", 
            "journal": "The Journal of biological chemistry", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
                    "id": "NP_950241.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Fisher DI, Safrany ST, Strike P, McLennan AG, Cartwright JL", 
            "date": "2002", 
            "pmid": "12370170"
        }, 
        {
            "title": "Discovery of molecular and catalytic diversity among human diphosphoinositol-polyphosphate phosphohydrolases. An expanding Nudt family.", 
            "url": "https://www.ncbi.nlm.nih.gov/pubmed/10777568", 
            "journal": "The Journal of biological chemistry", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
                    "id": "NP_950241.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Caffrey JJ, Safrany ST, Yang X, Shears SB", 
            "date": "2000", 
            "pmid": "10777568"
        }
    ], 
    "glycosylation": [], 
    "mutation": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A024RBG1#A0A024RBG1-1", 
            "isoform_ac": "A0A024RBG1-1", 
            "locus": {
                "end_pos": 148748953, 
                "start_pos": 148749495, 
                "chromosome": "1", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENST00000322209", 
                        "id": "ENST00000322209", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSP00000492425", 
                        "id": "ENSP00000492425", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A0A024RBG1-1|NUD4B_HUMAN Isoform 1 of Diphosphoinositol polyphosphate phosphohydrolase NUDT4B  OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1 CANONICAL=A0A024RBG1-1", 
                "length": 181, 
                "sequence": "MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR"
            }
        }
    ], 
    "pathway": [], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A024RBG1#function", 
            "annotation": "Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0A024RBG1#function", 
                    "id": "A0A024RBG1", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
            "annotation": "This paper demonstrates that KIAA0487 (AB007956) is the 3'-UTR for human diphosphoinositol polyphosphate phosphohydrolase type II", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
                    "id": "NP_950241.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
        "ac": "NP_950241.1", 
        "name": "diphosphoinositol polyphosphate phosphohydrolase 2 isoform beta; diphosphoinositol polyphosphate phosphohydrolase type 2; DIPP-2; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; nudix (nucleoside diphosphate linked moiety X)-type motif 4; Diphosphoinositol polyphosphate phosphohydrolase NUDT4B; Nucleoside diphosphate-linked moiety X motif 4B; Nudix hydrolase 4B; Nudix motif 4B.", 
        "summary": "The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008]."
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008486", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                                "id": "A0A024RBG1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "diphosphoinositol-polyphosphate diphosphatase activity", 
                        "id": "GO:0008486"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052840", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                                "id": "A0A024RBG1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "inositol diphosphate tetrakisphosphate diphosphatase activity", 
                        "id": "GO:0052840"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052842", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                                "id": "A0A024RBG1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "inositol diphosphate pentakisphosphate diphosphatase activity", 
                        "id": "GO:0052842"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                                "id": "A0A024RBG1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "RNA binding", 
                        "id": "GO:0003723"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                                "id": "A0A024RBG1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "metal ion binding", 
                        "id": "GO:0046872"
                    }
                ], 
                "total": 5, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
                                "id": "A0A024RBG1", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cytosol", 
                        "id": "GO:0005829"
                    }
                ], 
                "total": 1, 
                "name": "Cellular Component"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 9, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 7
        }, 
        {
            "end_pos": 156, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 154
        }
    ], 
    "crossref": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_950241.1", 
            "id": "NP_950241.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=18012", 
            "id": "18012", 
            "database": "HGNC"
        }, 
        {
            "url": "https://www.nextprot.org/entry/NX_A0A024RBG1", 
            "id": "NX_A0A024RBG1", 
            "database": "neXtProt"
        }, 
        {
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NUDT4B", 
            "id": "NUDT4B", 
            "database": "GeneCards"
        }, 
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173598", 
            "id": "ENSG00000173598", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000086", 
            "id": "IPR000086", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR015797", 
            "id": "IPR015797", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR020084", 
            "id": "IPR020084", 
            "database": "InterPro"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF00293", 
            "id": "PF00293", 
            "database": "Pfam"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/11163", 
            "id": "11163", 
            "database": "GeneID"
        }
    ], 
    "expression_disease": [], 
    "uniprot_ac": "A0A024RBG1", 
    "disease": [], 
    "mass": {
        "monoisotopic_mass": 20434.0, 
        "chemical_mass": 20434.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0A024RBG1", 
            "name": "NUDT4B; NUDT4; DIPP-2B; DIPP2; DIPP2alpha; DIPP2beta; HDCMB47P.", 
            "locus": {
                "end_pos": 148750099, 
                "start_pos": 148748894, 
                "chromosome": "1", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSG00000177144", 
                        "id": "ENSG00000177144", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ]
}